(data stored in ACNUC7421 zone)

EMBL: CP001743.PE617

CP001743.PE617       Location/Qualifiers
FT   CDS             610209..611591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0632"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG0395 ABC-type sugar transport system
FT                   permease component; InterPro IPR000515; KEGG: sme:SMa1362
FT                   putative inner-membrane permease; SPTR: A3TKH0 Sugar
FT                   permease of ABC transporter system; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; PFAM: Binding-protein-dependent transport system
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27399"
FT                   /protein_id="ADD27399.1"
FT                   /translation="MATQAIRPVRKLDERHLARQRWARAGWVYGTMLALAVFFIGPFYV
FT                   AFLGSLKDNPLEWPFRYSFAQTQPKNWAAAWRLGQLGAGNPWTGGFAPGAEIPFQISYF
FT                   VEEGQEPEPPTVTVPTRRAGAGLGAIFDEVQAAPYAQVSEVQEVSRRPAVVGGQPGQVV
FT                   TYAFTIRYPKGDATANQPTVPRLPLDVEAPRGQQYYAATLDPNRLERRGRVASWDSVTP
FT                   GFFGYVFRNYVRVFNEARDPNTGASFFLRWTANTFFVSLVVVLTTLLFASLGGYALARM
FT                   YLPGKNYLFAFIVFTMTVPSQATFISNYLVLRDLGLLGSLWGMIVWSAVGAGAVFIMKQ
FT                   FFESIPREIEEAALMDGATPVTTFFRIILPMAAPALGALTILTFQGMWNEFFKAAVVLS
FT                   GQQASYTLPLGLSFFRSAYGVAGDWGLMLASAFLSMIPIIILFVVFQRYFVEGVSTSAL
FT                   KG"
     MATQAIRPVR KLDERHLARQ RWARAGWVYG TMLALAVFFI GPFYVAFLGS LKDNPLEWPF        60
     RYSFAQTQPK NWAAAWRLGQ LGAGNPWTGG FAPGAEIPFQ ISYFVEEGQE PEPPTVTVPT       120
     RRAGAGLGAI FDEVQAAPYA QVSEVQEVSR RPAVVGGQPG QVVTYAFTIR YPKGDATANQ       180
     PTVPRLPLDV EAPRGQQYYA ATLDPNRLER RGRVASWDSV TPGFFGYVFR NYVRVFNEAR       240
     DPNTGASFFL RWTANTFFVS LVVVLTTLLF ASLGGYALAR MYLPGKNYLF AFIVFTMTVP       300
     SQATFISNYL VLRDLGLLGS LWGMIVWSAV GAGAVFIMKQ FFESIPREIE EAALMDGATP       360
     VTTFFRIILP MAAPALGALT ILTFQGMWNE FFKAAVVLSG QQASYTLPLG LSFFRSAYGV       420
     AGDWGLMLAS AFLSMIPIII LFVVFQRYFV EGVSTSALKG                             460
//

If you have problems or comments...

PBIL Back to PBIL home page