(data stored in ACNUC7421 zone)

EMBL: CP001743.PE62

CP001743.PE62        Location/Qualifiers
FT   CDS             54264..54785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0063"
FT                   /product="ATP-cone domain protein"
FT                   /note="PFAM: ATP-cone domain protein; SPTR: Q5SM09
FT                   Transcriptional repressor nrdR; InterPro
FT                   IPR005144:IPR003796; COGs: COG1327 transcriptional
FT                   regulator protein consists of a Zn-ribbon and ATP-cone
FT                   domains; KEGG: smd:Smed_0817 hypothetical protein; PFAM:
FT                   ATP cone domain; TIGRFAM: transcriptional regulator NrdR"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26844"
FT                   /protein_id="ADD26844.1"
FT                   /translation="MNCPFCGNPDSRVLDSRPSDEGSVIRRRRECPVCKRRFTTYERAQ
FT                   VEPLLVIKRSGRKETFDPNKLLRGLSLAARKRPIDPEVLQEFAFGFEDTVKEMEITSEE
FT                   IGLRSLAFLKELDPVAYIRFASVYREFDSLENFIEEVRKLDRKPGKGKKAQKAEEETPD
FT                   LADEAKLGTV"
     MNCPFCGNPD SRVLDSRPSD EGSVIRRRRE CPVCKRRFTT YERAQVEPLL VIKRSGRKET        60
     FDPNKLLRGL SLAARKRPID PEVLQEFAFG FEDTVKEMEI TSEEIGLRSL AFLKELDPVA       120
     YIRFASVYRE FDSLENFIEE VRKLDRKPGK GKKAQKAEEE TPDLADEAKL GTV              173
//

If you have problems or comments...

PBIL Back to PBIL home page