(data stored in ACNUC7421 zone)

EMBL: CP001743.PE620

CP001743.PE620       Location/Qualifiers
FT   CDS             614540..615823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0635"
FT                   /product="Polynucleotide adenylyltransferase region"
FT                   /note="PFAM: Polynucleotide adenylyltransferase region;
FT                   SPTR: A6DP87 Putative poly(A) polymerase; InterPro
FT                   IPR002646; COGs: COG0617 tRNA
FT                   nucleotidyltransferase/poly(A) polymerase; KEGG:
FT                   scl:sce1090 hypothetical protein; PFAM: Poly A polymerase
FT                   head domain; TIGRFAM: uncharacterized domain HDIG"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27402"
FT                   /protein_id="ADD27402.1"
FT                   /translation="MMDYRQVLQQLSFLPDLYLVGGAVRDILLGETPEDLDFATSAPPE
FT                   VVMRLAKAQGLEAIPTGLEHGTVTILIDHHPYEVTTFRRDVETYGRKARVAWGQSIEED
FT                   LARRDFTIGAIAMDAAGRVIDPYGGQQDLEAGVLRAVGDPAQRFREDYLRVIRAGRFAA
FT                   RYGFEIEPRTLQAARAAAPEVLSHVAIERVTAEFDKAFQNGTPSRFLRYLYDLEILQRL
FT                   IPEFEDTHLLLQNPRWHPEGDVLTHVLQVVDRAPPPYRWHALLHDIGKKDTARWRPEGW
FT                   YSFYGHERVGAGLIPRIARDLRLPNHLRDELVVTTALHMVPVFTKPTPAAIRKFQAQAG
FT                   PHLPALRALYEADGAGRRSKESWKFFEPQPVPVQPVLLGRHLIERGHKPGKVFSRMLKA
FT                   AYDWQLDSGETDIEALYRVALRALEREA"
     MMDYRQVLQQ LSFLPDLYLV GGAVRDILLG ETPEDLDFAT SAPPEVVMRL AKAQGLEAIP        60
     TGLEHGTVTI LIDHHPYEVT TFRRDVETYG RKARVAWGQS IEEDLARRDF TIGAIAMDAA       120
     GRVIDPYGGQ QDLEAGVLRA VGDPAQRFRE DYLRVIRAGR FAARYGFEIE PRTLQAARAA       180
     APEVLSHVAI ERVTAEFDKA FQNGTPSRFL RYLYDLEILQ RLIPEFEDTH LLLQNPRWHP       240
     EGDVLTHVLQ VVDRAPPPYR WHALLHDIGK KDTARWRPEG WYSFYGHERV GAGLIPRIAR       300
     DLRLPNHLRD ELVVTTALHM VPVFTKPTPA AIRKFQAQAG PHLPALRALY EADGAGRRSK       360
     ESWKFFEPQP VPVQPVLLGR HLIERGHKPG KVFSRMLKAA YDWQLDSGET DIEALYRVAL       420
     RALEREA                                                                 427
//

If you have problems or comments...

PBIL Back to PBIL home page