(data stored in ACNUC7421 zone)

EMBL: CP001743.PE622

CP001743.PE622       Location/Qualifiers
FT   CDS             complement(616559..619327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0637"
FT                   /product="Tetratricopeptide domain protein"
FT                   /note="SMART: Tetratricopeptide domain protein; InterPro
FT                   IPR013026; KEGG: hypothetical protein; SPTR: A7T5N6
FT                   Predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27404"
FT                   /protein_id="ADD27404.1"
FT                   /translation="MGEVSTLWQVHLETLRPHLSGRDHRGKKGSLRWLEAAVAERGGRA
FT                   GTVRNILYKDLGSPEEKLRLFEVICDLYTESGLEAPPLPSELALESARRALGRDKRRLF
FT                   RRFVRALEQGEKPQMVVVGGAATGKGVLLAAVERAVPGCLMVNLGGELAQHLHPLAEKL
FT                   GLELEGILSQLSPTQPYALQAALQDELRNELAGALNACGKPLLLRAEKEGQIGGLSLRD
FT                   TQGNPVGLAAWIEPLLRRLTIPFLAGLSEPPPNLAWHPLSAPSRAEARRYVKDRLPDLP
FT                   PERVEALVNQAGRNFAELSRLVLLEAAQTQDSPSAYNLAQDTALRPILYALAVLSPEAD
FT                   PGIPVPLLEKAIGKGLEHLSQAERALLAPMGEGKVRPALRSLLPEVPEKEARRLHTLAL
FT                   DFFRSDLFRQLHHARGAQRLDKLLELLSQDPSRLALLPTLWVESQSWPTLERERLAMAV
FT                   VRYRAVLGQYAHPEALEALELLFHSTDPAVQAWARVKAAEARVDAGDFPAALQLLPSPE
FT                   TLSGEIGAEGLLVWAAVERWQGDYAQAEAYVQQALSLPIQPFLADRVRLWQGLVAKDAG
FT                   RFEEALEALRQVSHDPLLVGRARYQSGDLLLRTGRVYEAEAQMRQGLQALEASGAPPEE
FT                   IARVRARFGTALRRIGNFEEAERYLYQSIREASDEFIRARAMSEASVLELARGRPLEAL
FT                   ALLAEAEAYLREVRERPEEAHYRHRRTLYRIAVAYWVRASGLPYLPPYVGGQKAPESLK
FT                   ILRQLREELLSKKLPGDRYTALSIDVALKLSLLMPAPKAEAMMQGCLQQSDPYFQAQAR
FT                   LGYAETLARQEKWAEALAQVVQIGDLQDPGVQSWKLGLETQALLGLGQEEAAWKKLQTC
FT                   AGLPAPYRAQLGRVLGKIWPAEALRTRLKTRSPLALDDCLALHLSQASPAQ"
     MGEVSTLWQV HLETLRPHLS GRDHRGKKGS LRWLEAAVAE RGGRAGTVRN ILYKDLGSPE        60
     EKLRLFEVIC DLYTESGLEA PPLPSELALE SARRALGRDK RRLFRRFVRA LEQGEKPQMV       120
     VVGGAATGKG VLLAAVERAV PGCLMVNLGG ELAQHLHPLA EKLGLELEGI LSQLSPTQPY       180
     ALQAALQDEL RNELAGALNA CGKPLLLRAE KEGQIGGLSL RDTQGNPVGL AAWIEPLLRR       240
     LTIPFLAGLS EPPPNLAWHP LSAPSRAEAR RYVKDRLPDL PPERVEALVN QAGRNFAELS       300
     RLVLLEAAQT QDSPSAYNLA QDTALRPILY ALAVLSPEAD PGIPVPLLEK AIGKGLEHLS       360
     QAERALLAPM GEGKVRPALR SLLPEVPEKE ARRLHTLALD FFRSDLFRQL HHARGAQRLD       420
     KLLELLSQDP SRLALLPTLW VESQSWPTLE RERLAMAVVR YRAVLGQYAH PEALEALELL       480
     FHSTDPAVQA WARVKAAEAR VDAGDFPAAL QLLPSPETLS GEIGAEGLLV WAAVERWQGD       540
     YAQAEAYVQQ ALSLPIQPFL ADRVRLWQGL VAKDAGRFEE ALEALRQVSH DPLLVGRARY       600
     QSGDLLLRTG RVYEAEAQMR QGLQALEASG APPEEIARVR ARFGTALRRI GNFEEAERYL       660
     YQSIREASDE FIRARAMSEA SVLELARGRP LEALALLAEA EAYLREVRER PEEAHYRHRR       720
     TLYRIAVAYW VRASGLPYLP PYVGGQKAPE SLKILRQLRE ELLSKKLPGD RYTALSIDVA       780
     LKLSLLMPAP KAEAMMQGCL QQSDPYFQAQ ARLGYAETLA RQEKWAEALA QVVQIGDLQD       840
     PGVQSWKLGL ETQALLGLGQ EEAAWKKLQT CAGLPAPYRA QLGRVLGKIW PAEALRTRLK       900
     TRSPLALDDC LALHLSQASP AQ                                                922
//

If you have problems or comments...

PBIL Back to PBIL home page