(data stored in ACNUC7421 zone)

EMBL: CP001743.PE623

CP001743.PE623       Location/Qualifiers
FT   CDS             complement(619371..620147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0638"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein; SPTR: B8XNP4 Platelet
FT                   glycoprotein Ib alpha polypeptide; PFAM: PEGA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27405"
FT                   /protein_id="ADD27405.1"
FT                   /translation="MNALLLWILGILGVLIMLWGLTRLPRGGLAWLGFGLVLGLAGLGG
FT                   AWLHQQYGTTVFWGLGILGVLLLVWALLNLRSRLAGWSAGLAVLLVLTGFGSIVLLNSS
FT                   SPNLLTSGTIPNPLNNFQTDPGSAPDGPTTNPTPPAETTPEPTPTPPETDPSQPATEPS
FT                   PSPAEPAPTAPVASGSVREVDPACPCLLSVRVKAPNPTVRILQDGTEVASSKLEYSSFS
FT                   LEAGDYTLQVEAPGYRTLSTLINVPRNKNLEVELAQ"
     MNALLLWILG ILGVLIMLWG LTRLPRGGLA WLGFGLVLGL AGLGGAWLHQ QYGTTVFWGL        60
     GILGVLLLVW ALLNLRSRLA GWSAGLAVLL VLTGFGSIVL LNSSSPNLLT SGTIPNPLNN       120
     FQTDPGSAPD GPTTNPTPPA ETTPEPTPTP PETDPSQPAT EPSPSPAEPA PTAPVASGSV       180
     REVDPACPCL LSVRVKAPNP TVRILQDGTE VASSKLEYSS FSLEAGDYTL QVEAPGYRTL       240
     STLINVPRNK NLEVELAQ                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page