(data stored in ACNUC7421 zone)

EMBL: CP001743.PE624

CP001743.PE624       Location/Qualifiers
FT   CDS             620298..621074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0639"
FT                   /product="5-carboxymethyl-2-hydroxymuconateDelta-isomerase"
FT                   /EC_number="5.3.3.10"
FT                   /note="PRIAM: 5-carboxymethyl-2-hydroxymuconate
FT                   Delta-isomerase; PFAM: fumarylacetoacetate (FAA) hydrolase;
FT                   InterPro IPR002529; KEGG: scl:sce2870 fumarylacetoacetase;
FT                   COGs: COG0179 2-keto-4-pentenoate
FT                   hydratase/2-oxohepta-3-ene-1 7-dioic acid hydratase
FT                   (catechol pathway); SPTR: A4KKP9 Putative uncharacterized
FT                   protein; PFAM: Domain of unknown function (DUF2437);
FT                   Fumarylacetoacetate (FAA) hydrolase family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27406"
FT                   /protein_id="ADD27406.1"
FT                   /translation="MKLVRFDAGQWGVLEGETIHETDGPAGNPTGRHFDLGGVTLLAPA
FT                   TPTKIVCVGRNYLDHIREMGHDFGGDLPKEPGLFLKGPNTLAHPANPARPERSGDVVPY
FT                   PSFTNLLHYEGELAVVIESRMKNVPESEALEHVLGYTCALDVTARDKQKTDLQWVRAKS
FT                   ADKFCPLGPWLVTSLDPQNTTLRTYVNGELRQEAHTSLMIFSVAKILSYISSFMTLEPG
FT                   DVVLTGTPEGVGELKPGDHVEVAIEGIGDLHTRIGH"
     MKLVRFDAGQ WGVLEGETIH ETDGPAGNPT GRHFDLGGVT LLAPATPTKI VCVGRNYLDH        60
     IREMGHDFGG DLPKEPGLFL KGPNTLAHPA NPARPERSGD VVPYPSFTNL LHYEGELAVV       120
     IESRMKNVPE SEALEHVLGY TCALDVTARD KQKTDLQWVR AKSADKFCPL GPWLVTSLDP       180
     QNTTLRTYVN GELRQEAHTS LMIFSVAKIL SYISSFMTLE PGDVVLTGTP EGVGELKPGD       240
     HVEVAIEGIG DLHTRIGH                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page