(data stored in ACNUC7421 zone)

EMBL: CP001743.PE626

CP001743.PE626       Location/Qualifiers
FT   CDS             complement(622427..623944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0641"
FT                   /product="Fibronectin-binding A domain protein"
FT                   /note="PFAM: Fibronectin-binding A domain protein; protein
FT                   of unknown function DUF814; SPTR: A6P056 Putative
FT                   uncharacterized protein; InterPro IPR008616:IPR008532;
FT                   COGs: COG1293 RNA-binding protein homologous to eukaryotic
FT                   snRNP; KEGG: bsu:BSU15640 hypothetical protein; PFAM:
FT                   Domain of unknown function (DUF814); Fibronectin-binding
FT                   protein A N-terminus (FbpA)"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27408"
FT                   /protein_id="ADD27408.1"
FT                   /translation="MEGLQIHAALRTLAPQLPRRSLGWAFPDEGTAALLLEGLGNLLLR
FT                   YRPPHPLLALEADRVAGEAKTPFQRLLEARCKGRLLKIEQLKLDRVVFLEFEGEKGFVD
FT                   TAPTRLVFELTGRNANLMVLDLEGRIIGIDRPVTPAINRYRELRSGLFYTPPPPYQKLD
FT                   PRTLQEDGLKPFVGQPLEQLIKNLDGVGKALGAELCRRAHLRPQTPLEPAHLPLIHKVI
FT                   HSLVEQPSLQTASPDLQTAWAQEEAEALRKPLREALQRQLRTLQARLGDAHNALERLEE
FT                   AQRLRNWGDLLMAYGHQLPPGPTAKLEDFSGQMVEIPLEAGLSPIQNASRFYARAKRLE
FT                   ANAERALEQIPAMEAQIAGLEQELAQLEHLSRQALQALKRKTREKGPQLGLRLTSPSGF
FT                   EVWVGRNSKENDLLTRMAHSEDLWFHAQGLPGSHVILRTQGRPAPLPDLLYAAQLAAHH
FT                   SKARGEKNVPVDYTAKKHVWRPRKAAPGQVLYTQVKTLFVDARLPTS"
     MEGLQIHAAL RTLAPQLPRR SLGWAFPDEG TAALLLEGLG NLLLRYRPPH PLLALEADRV        60
     AGEAKTPFQR LLEARCKGRL LKIEQLKLDR VVFLEFEGEK GFVDTAPTRL VFELTGRNAN       120
     LMVLDLEGRI IGIDRPVTPA INRYRELRSG LFYTPPPPYQ KLDPRTLQED GLKPFVGQPL       180
     EQLIKNLDGV GKALGAELCR RAHLRPQTPL EPAHLPLIHK VIHSLVEQPS LQTASPDLQT       240
     AWAQEEAEAL RKPLREALQR QLRTLQARLG DAHNALERLE EAQRLRNWGD LLMAYGHQLP       300
     PGPTAKLEDF SGQMVEIPLE AGLSPIQNAS RFYARAKRLE ANAERALEQI PAMEAQIAGL       360
     EQELAQLEHL SRQALQALKR KTREKGPQLG LRLTSPSGFE VWVGRNSKEN DLLTRMAHSE       420
     DLWFHAQGLP GSHVILRTQG RPAPLPDLLY AAQLAAHHSK ARGEKNVPVD YTAKKHVWRP       480
     RKAAPGQVLY TQVKTLFVDA RLPTS                                             505
//

If you have problems or comments...

PBIL Back to PBIL home page