(data stored in ACNUC7421 zone)

EMBL: CP001743.PE628

CP001743.PE628       Location/Qualifiers
FT   CDS             complement(624832..626154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0643"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; histidine kinase HAMP
FT                   region domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; histidine kinase HAMP region domain
FT                   protein; histidine kinase A domain protein;
FT                   InterProIPR004358:IPR003594:IPR003661:IPR003660:IPR 005467;
FT                   KEGG: ppf:Pput_1406 integral membrane sensor signal
FT                   transduction histidine kinase; COGs: COG0642 Signal
FT                   transduction histidine kinase; SPTR: A6P0U2 Sensor protein;
FT                   PFAM: Histidine kinase-, DNA gyrase B-, and HSP90-like
FT                   ATPase; His Kinase A (phosphoacceptor) domain; HAMP domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27410"
FT                   /protein_id="ADD27410.1"
FT                   /translation="MPPSKAVQALHILLSRPKGRLLGGFRSRLLLGLSSVVVLTALLVG
FT                   VLGFLQFQSTLSQEAWQDLISATNIVEQALLITPEQVLLNPDRLPRLAELGNSRFRVIR
FT                   TEQVFLEIGGRYPTQSTGWIKTERPLEYGFVLQAALETHSQSEALRTFWQTELLALPIS
FT                   LLLALVVAYLLFGYLMHPVRHLTEATHAIAQQRFPKPIPVPPGQDELSDLAESFNRMTQ
FT                   AVEGFLERERNFSRYASHELRTPLATLRAQIEALEQGLLTPQESLPAIKRSLERLEHLL
FT                   AALLALTRIPHKNPEPVEVGAVLHAVVQNLLLKEQQRITLKGNLGAQVLGYEELLQQAL
FT                   SNLVNNALKFSQGQVEVEVRQGAVIQIHIRDRGPGVPEKDIPRLGTPFLRVQPKVDGMG
FT                   LGLALVRHIASVMGGELEFSNRPGGGLEAILSLPSLEVSHA"
     MPPSKAVQAL HILLSRPKGR LLGGFRSRLL LGLSSVVVLT ALLVGVLGFL QFQSTLSQEA        60
     WQDLISATNI VEQALLITPE QVLLNPDRLP RLAELGNSRF RVIRTEQVFL EIGGRYPTQS       120
     TGWIKTERPL EYGFVLQAAL ETHSQSEALR TFWQTELLAL PISLLLALVV AYLLFGYLMH       180
     PVRHLTEATH AIAQQRFPKP IPVPPGQDEL SDLAESFNRM TQAVEGFLER ERNFSRYASH       240
     ELRTPLATLR AQIEALEQGL LTPQESLPAI KRSLERLEHL LAALLALTRI PHKNPEPVEV       300
     GAVLHAVVQN LLLKEQQRIT LKGNLGAQVL GYEELLQQAL SNLVNNALKF SQGQVEVEVR       360
     QGAVIQIHIR DRGPGVPEKD IPRLGTPFLR VQPKVDGMGL GLALVRHIAS VMGGELEFSN       420
     RPGGGLEAIL SLPSLEVSHA                                                   440
//

If you have problems or comments...

PBIL Back to PBIL home page