(data stored in ACNUC7421 zone)

EMBL: CP001743.PE63

CP001743.PE63        Location/Qualifiers
FT   CDS             54821..55558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0064"
FT                   /product="protein of unknown function DUF164"
FT                   /note="PFAM: protein of unknown function DUF164; SPTR:
FT                   A6DEI7 Putative uncharacterized protein; InterPro
FT                   IPR003743; COGs: COG1579 Zn-ribbon protein possibly nucleic
FT                   acid-binding; KEGG: protein of unknown function DUF164 ;
FT                   K07164; PFAM: Putative zinc ribbon domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26845"
FT                   /protein_id="ADD26845.1"
FT                   /translation="MSDPLAELNRLQERDLELDQIREDQSRVPDELAQAREHFRKLEIS
FT                   LGDLQEQLREVRLAYNKLDLELQDLKSKREKAKAAQAQATGAKEQTQYGEQIRQLSGLI
FT                   EDLEGNNKDIVGQIMPLLEQIEKLEAELAQVKAQMEEARPKLEALETANQARVDALEAE
FT                   YQSKKVSRDQLAATIPTAIVKEYESIRRARKGTGLTKMAKAGNGYRCTACNVQLPMHVA
FT                   QQVHQASKVVRCPSCGRILWKGA"
     MSDPLAELNR LQERDLELDQ IREDQSRVPD ELAQAREHFR KLEISLGDLQ EQLREVRLAY        60
     NKLDLELQDL KSKREKAKAA QAQATGAKEQ TQYGEQIRQL SGLIEDLEGN NKDIVGQIMP       120
     LLEQIEKLEA ELAQVKAQME EARPKLEALE TANQARVDAL EAEYQSKKVS RDQLAATIPT       180
     AIVKEYESIR RARKGTGLTK MAKAGNGYRC TACNVQLPMH VAQQVHQASK VVRCPSCGRI       240
     LWKGA                                                                   245
//

If you have problems or comments...

PBIL Back to PBIL home page