(data stored in ACNUC7421 zone)

EMBL: CP001743.PE632

CP001743.PE632       Location/Qualifiers
FT   CDS             628501..628935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0647"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR012902:IPR001120; KEGG: vfm:VFMJ11_0359
FT                   MshD; PFAM: Prokaryotic N-terminal methylation motif;
FT                   TIGRFAM: prepilin-type N-terminal cleavage/methylation
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27414"
FT                   /protein_id="ADD27414.1"
FT                   /translation="MQNRGITLVELLIALAVLGVAFGVLVFSQVTNYRATARAGVVSQV
FT                   KDTATQILENQVGVVLANFTRYYNGCPTGSETGCYGSGFLINSGIDEGLDGEGQILIQS
FT                   SATSQGITINLATKVSCYDGFASRTAAIGVGSLEPCPRPN"
     MQNRGITLVE LLIALAVLGV AFGVLVFSQV TNYRATARAG VVSQVKDTAT QILENQVGVV        60
     LANFTRYYNG CPTGSETGCY GSGFLINSGI DEGLDGEGQI LIQSSATSQG ITINLATKVS       120
     CYDGFASRTA AIGVGSLEPC PRPN                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page