(data stored in ACNUC7421 zone)

EMBL: CP001743.PE64

CP001743.PE64        Location/Qualifiers
FT   CDS             55575..56066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0065"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; InterPro IPR000086; KEGG:
FT                   smt:Smal_2419 NUDIX hydrolase; SPTR: A6DL70 8-oxodGTP
FT                   nucleoside triphosphatase; PFAM: NUDIX domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26846"
FT                   /protein_id="ADD26846.1"
FT                   /translation="MPYTPILATLGFVLSPDRQEVLLVYRNARSQDPAYGLYNGLGGKL
FT                   EPHEDVVAGMRREILEESGLTALQLHLRGTISWPGFGRQGEDWFGFIFLITEWTGSPHA
FT                   ANGEGELHWVPIQKILRQELPMWPGDRYFLPLVFDADPRPFHGVMPYRGGQVLSWSFSR
FT                   "
     MPYTPILATL GFVLSPDRQE VLLVYRNARS QDPAYGLYNG LGGKLEPHED VVAGMRREIL        60
     EESGLTALQL HLRGTISWPG FGRQGEDWFG FIFLITEWTG SPHAANGEGE LHWVPIQKIL       120
     RQELPMWPGD RYFLPLVFDA DPRPFHGVMP YRGGQVLSWS FSR                         163
//

If you have problems or comments...

PBIL Back to PBIL home page