(data stored in ACNUC7421 zone)

EMBL: CP001743.PE640

CP001743.PE640       Location/Qualifiers
FT   CDS             636340..636924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0655"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: response regulator receiver; regulatory
FT                   protein LuxR; Sigma-70 region 4 type 2; SMART: response
FT                   regulator receiver; regulatory protein LuxR; InterPro
FT                   IPR000792:IPR013249:IPR001789; KEGG: pag:PLES_10991
FT                   two-component response regulator NarL; COGs: COG2197
FT                   Response regulator containing a CheY-like receiver domain
FT                   and an HTH DNA-binding domain; SPTR: A3TPE2 Two-component
FT                   system, regulatory protein; PFAM: Bacterial regulatory
FT                   proteins, luxR family; Response regulator receiver domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27422"
FT                   /protein_id="ADD27422.1"
FT                   /translation="MRLLIADDHPLFRMGLRAALEREGFAVVAEAGDGQEAVKLGLELL
FT                   PDGVLLDVRMPQMDGITATRMLREQRYNGLIALLTTFNEPVLVQQAAYAGADAYWSKEL
FT                   PPEALAERLRRLGLGLEPRLRAPELPRLTAREQEVLQWMAQGLSTKEIARQMHISPETV
FT                   KDHLLRLYEKLEARNRVEALERARSLGLLSV"
     MRLLIADDHP LFRMGLRAAL EREGFAVVAE AGDGQEAVKL GLELLPDGVL LDVRMPQMDG        60
     ITATRMLREQ RYNGLIALLT TFNEPVLVQQ AAYAGADAYW SKELPPEALA ERLRRLGLGL       120
     EPRLRAPELP RLTAREQEVL QWMAQGLSTK EIARQMHISP ETVKDHLLRL YEKLEARNRV       180
     EALERARSLG LLSV                                                         194
//

If you have problems or comments...

PBIL Back to PBIL home page