(data stored in ACNUC7421 zone)

EMBL: CP001743.PE641

CP001743.PE641       Location/Qualifiers
FT   CDS             637033..639138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0656"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR002048; KEGG: oan:Oant_4858 outer
FT                   membrane autotransporter barrel domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27423"
FT                   /protein_id="ADD27423.1"
FT                   /translation="MSDTRGLALVSTLVFMFIVIVLVSIAMLSSLNNRRNAQDALRTSQ
FT                   AQFAAEAGLERAVARLWHQVLASATSRSVTAYGVELDRMGLTNGTTIPSLFGAPQSLGD
FT                   GSSFVVQVSRQDDTRPDPDAIVLTVTSTGTLADGTTRRLRQVFRVDRAYFPFDYALLTN
FT                   NAECIFCHLEVKSLDALRGNPNPNDPSTWWRRAKVGVLESLIMRDDEEAGVVHGPLVAR
FT                   GTISRQYSGAIGPSSRYYTTMRPGDTRIRSATPITTTPADCSTPSNCTTPQNFYYNYPD
FT                   SSSLAAFGNRFPDGELPDRFPLPIPDANHNRLIDDAEWNAEVGSSLAGTNESYSAGTIT
FT                   AAMILNPAGRVAWPGGSAVQTRTSADLGQNPTNVLLDGSVIPIELSGTVFINGDVVLRG
FT                   FVRGNGTLLARGNLYVMGDLTYDCGTGSGLVPCDYSNPSRLPQLNLIAGGNLLVGDFMT
FT                   VQSDIESLSEEQMLSTRSNQPTISFCRENPTDAACYPEERPRPNLALTEIANFNRRELQ
FT                   RYLRDNSYRPRFYTFGEDRIYFATGCSHQPQRYGEYSTIAAGARVSFCRGDTILSSSTL
FT                   TAEQASRILAGAVRYEVTSSSFNNAILKNLWANSMNARGTGPLRTDGLLYSANAIFGLA
FT                   QRKYTKLGGRWDLRGALVAADTGILVPGPGDGSSGLTIYHDSRLRPRVPGGQQAQLRRG
FT                   VWEVVGQ"
     MSDTRGLALV STLVFMFIVI VLVSIAMLSS LNNRRNAQDA LRTSQAQFAA EAGLERAVAR        60
     LWHQVLASAT SRSVTAYGVE LDRMGLTNGT TIPSLFGAPQ SLGDGSSFVV QVSRQDDTRP       120
     DPDAIVLTVT STGTLADGTT RRLRQVFRVD RAYFPFDYAL LTNNAECIFC HLEVKSLDAL       180
     RGNPNPNDPS TWWRRAKVGV LESLIMRDDE EAGVVHGPLV ARGTISRQYS GAIGPSSRYY       240
     TTMRPGDTRI RSATPITTTP ADCSTPSNCT TPQNFYYNYP DSSSLAAFGN RFPDGELPDR       300
     FPLPIPDANH NRLIDDAEWN AEVGSSLAGT NESYSAGTIT AAMILNPAGR VAWPGGSAVQ       360
     TRTSADLGQN PTNVLLDGSV IPIELSGTVF INGDVVLRGF VRGNGTLLAR GNLYVMGDLT       420
     YDCGTGSGLV PCDYSNPSRL PQLNLIAGGN LLVGDFMTVQ SDIESLSEEQ MLSTRSNQPT       480
     ISFCRENPTD AACYPEERPR PNLALTEIAN FNRRELQRYL RDNSYRPRFY TFGEDRIYFA       540
     TGCSHQPQRY GEYSTIAAGA RVSFCRGDTI LSSSTLTAEQ ASRILAGAVR YEVTSSSFNN       600
     AILKNLWANS MNARGTGPLR TDGLLYSANA IFGLAQRKYT KLGGRWDLRG ALVAADTGIL       660
     VPGPGDGSSG LTIYHDSRLR PRVPGGQQAQ LRRGVWEVVG Q                           701
//

If you have problems or comments...

PBIL Back to PBIL home page