(data stored in ACNUC7421 zone)

EMBL: CP001743.PE642

CP001743.PE642       Location/Qualifiers
FT   CDS             639135..639590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0657"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR012902:IPR001120; KEGG: mms:mma_3359
FT                   type IV pilus assembly related protein; PFAM: Prokaryotic
FT                   N-terminal methylation motif; TIGRFAM: prepilin-type
FT                   N-terminal cleavage/methylation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27424"
FT                   /protein_id="ADD27424.1"
FT                   /translation="MNAPSQKGISLLELLIALAVLGILLGVGLVSLSAYRQSLVIREAA
FT                   TQVATELQSIRQQARRQSLNFSFQAVEGGNTYKAGRTAELASLPSRSLPPGVVFQRVPA
FT                   GGGGVTFLAPYGVVDAANRTFTLRGPGNRVLNVHVVGSTGKVVVRAP"
     MNAPSQKGIS LLELLIALAV LGILLGVGLV SLSAYRQSLV IREAATQVAT ELQSIRQQAR        60
     RQSLNFSFQA VEGGNTYKAG RTAELASLPS RSLPPGVVFQ RVPAGGGGVT FLAPYGVVDA       120
     ANRTFTLRGP GNRVLNVHVV GSTGKVVVRA P                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page