(data stored in ACNUC7421 zone)

EMBL: CP001743.PE643

CP001743.PE643       Location/Qualifiers
FT   CDS             639580..639954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0658"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR012902; PFAM: Prokaryotic N-terminal
FT                   methylation motif; TIGRFAM: prepilin-type N-terminal
FT                   cleavage/methylation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27425"
FT                   /protein_id="ADD27425.1"
FT                   /translation="MRRKAFSLVEVMVALAILSITILILSYFGSSFTLTRNAQIDTQAQ
FT                   AFARSYFDTLRARWSTRAAFAAGTPPSVALPSGFSNLTIATEDVQTIGTQVVLRRVTLQ
FT                   FTGPQNRPYRFTTEVVHPPQ"
     MRRKAFSLVE VMVALAILSI TILILSYFGS SFTLTRNAQI DTQAQAFARS YFDTLRARWS        60
     TRAAFAAGTP PSVALPSGFS NLTIATEDVQ TIGTQVVLRR VTLQFTGPQN RPYRFTTEVV       120
     HPPQ                                                                    124
//

If you have problems or comments...

PBIL Back to PBIL home page