(data stored in ACNUC7421 zone)

EMBL: CP001743.PE645

CP001743.PE645       Location/Qualifiers
FT   CDS             complement(640779..642578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0660"
FT                   /product="GTP-binding protein LepA"
FT                   /note="TIGRFAM: GTP-binding protein LepA; small GTP-binding
FT                   protein; PFAM: GTP-binding protein LepA domain protein;
FT                   elongation factor G domain protein; elongation factor Tu
FT                   domain 2 protein; protein synthesis factor GTP-binding;
FT                   InterProIPR000795:IPR000640:IPR013842:IPR004161:IPR
FT                   006297:IPR005225; KEGG: bha:BH1342 GTP-binding protein
FT                   LepA; COGs: COG0481 Membrane GTPase LepA; SPTR: Q5SKA7
FT                   GTP-binding protein lepA; PFAM: Elongation factor G
FT                   C-terminus; GTP-binding protein LepA C-terminus; Elongation
FT                   factor Tu domain 2; Elongation factor Tu GTP binding
FT                   domain; TIGRFAM: GTP-binding protein LepA; small
FT                   GTP-binding protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27427"
FT                   /protein_id="ADD27427.1"
FT                   /translation="MQERIRNFSIIAHVDHGKSTLADRILQMTKAVSDREMREQFLDSL
FT                   ELERERGITIKASAVRLFYQSKAGETYIFNLIDTPGHVDFGYEVSRALAAVEGVLLVVD
FT                   ASQGVEAQTIANFYLAMEHEHTIIPVINKIDLPGAQPLEVALEVEEVLGIPADDCIFAS
FT                   GKTGQGVDDILEAIVARIPAPKGRPEHPLQALIFDSIFDAYQGVIPYVRVMDGSIQPGD
FT                   TIRIWSTGKVFEVDKVGVFRPGALEPVARLGPGEVGWVTAAIREIGDAQVGDTITSAQN
FT                   PCEAPYPGFQPAKPVVFAGLYPTDTQEYNRLREALEKLKLNDAALSFEPETSEALGFGF
FT                   RCGFLGLLHAEIVQERLEREFDLDLISTAPSVIYRVKLTNGEEIEIHNPSELPNPDKIE
FT                   AIYEPYVKLTVYTPEEYVGSIMQLLQEKRGKMSNMHYVGKRVELVYEVPFGEILYDFHD
FT                   RLKSISRGYASMDYEQAGYQEGDLVKVSILVNEEPVDALAFIAHKDKAYGIGREIVDKL
FT                   AEVIPRQQFAVPIQAAIGGKIIARATVKALRKDVLAKCYGGDVTRKKKLLEKQKEGKKR
FT                   MKAIGKVDVPQEAFLAVLSAGRD"
     MQERIRNFSI IAHVDHGKST LADRILQMTK AVSDREMREQ FLDSLELERE RGITIKASAV        60
     RLFYQSKAGE TYIFNLIDTP GHVDFGYEVS RALAAVEGVL LVVDASQGVE AQTIANFYLA       120
     MEHEHTIIPV INKIDLPGAQ PLEVALEVEE VLGIPADDCI FASGKTGQGV DDILEAIVAR       180
     IPAPKGRPEH PLQALIFDSI FDAYQGVIPY VRVMDGSIQP GDTIRIWSTG KVFEVDKVGV       240
     FRPGALEPVA RLGPGEVGWV TAAIREIGDA QVGDTITSAQ NPCEAPYPGF QPAKPVVFAG       300
     LYPTDTQEYN RLREALEKLK LNDAALSFEP ETSEALGFGF RCGFLGLLHA EIVQERLERE       360
     FDLDLISTAP SVIYRVKLTN GEEIEIHNPS ELPNPDKIEA IYEPYVKLTV YTPEEYVGSI       420
     MQLLQEKRGK MSNMHYVGKR VELVYEVPFG EILYDFHDRL KSISRGYASM DYEQAGYQEG       480
     DLVKVSILVN EEPVDALAFI AHKDKAYGIG REIVDKLAEV IPRQQFAVPI QAAIGGKIIA       540
     RATVKALRKD VLAKCYGGDV TRKKKLLEKQ KEGKKRMKAI GKVDVPQEAF LAVLSAGRD        599
//

If you have problems or comments...

PBIL Back to PBIL home page