(data stored in ACNUC7421 zone)

EMBL: CP001743.PE647

CP001743.PE647       Location/Qualifiers
FT   CDS             643835..644062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0662"
FT                   /product="cold-shock DNA-binding domain protein"
FT                   /note="PFAM: Cold-shock protein DNA-binding; Ribonuclease B
FT                   OB region domain; SMART: Cold shock protein; InterPro
FT                   IPR002059:IPR013223:IPR011129; KEGG: bcy:Bcer98_2221
FT                   cold-shock DNA-binding domain-containing protein; COGs:
FT                   COG1278 Cold shock protein; SPTR: A6CJW0 Cold-shock domain
FT                   family protein; PFAM: 'Cold-shock' DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27429"
FT                   /protein_id="ADD27429.1"
FT                   /translation="MQKGKVKWFNAEKGYGFIQREEGEPDVFVHYSAIQSRGFRTLNEG
FT                   DVVTFEIEPGKNGKGPQAANVSVVEPAKRF"
     MQKGKVKWFN AEKGYGFIQR EEGEPDVFVH YSAIQSRGFR TLNEGDVVTF EIEPGKNGKG        60
     PQAANVSVVE PAKRF                                                         75
//

If you have problems or comments...

PBIL Back to PBIL home page