(data stored in ACNUC7421 zone)

EMBL: CP001743.PE649

CP001743.PE649       Location/Qualifiers
FT   CDS             complement(644494..645231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0664"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) reductase"
FT                   /EC_number="1.1.1.100"
FT                   /note="TIGRFAM: 3-oxoacyl-(acyl-carrier-protein) reductase;
FT                   PFAM: short-chain dehydrogenase/reductase SDR; KR domain
FT                   protein; Male sterility domain;
FT                   InterProIPR002347:IPR002424:IPR002198:IPR013120:IPR
FT                   013968:IPR011284; KEGG: bha:BH2491 3-oxoacyl-(acyl-carrier
FT                   protein) reductase; COGs: COG1028 Dehydrogenase with
FT                   different specificities (related to short-chain alcohol
FT                   dehydrogenase); SPTR: A6CS72
FT                   3-ketoacyl-(Acyl-carrier-protein) reductase; PFAM: short
FT                   chain dehydrogenase; TIGRFAM:
FT                   3-oxoacyl-(acyl-carrier-protein) reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27431"
FT                   /protein_id="ADD27431.1"
FT                   /translation="MRKALVTGSSRGIGKAIALELARRGYALAVHYAGNQAAAEATAAE
FT                   AQALGASQVVVLGADLSSAQAAQKLVADANAALGGLEVLVNNAGITRDTLLIRMKDEDW
FT                   DTVIATNLSAIFHTTREAIKLMMRARWGRVINISSVVGILGNPGQANYVAAKAGLIGFT
FT                   KSVAKEYATRGITVNAVAPGFIESDMTAKLPEQVVAEYLKQIPAGRLGKPEEVAKAVAF
FT                   LASDDAAYITGQTLCVDGGMTPH"
     MRKALVTGSS RGIGKAIALE LARRGYALAV HYAGNQAAAE ATAAEAQALG ASQVVVLGAD        60
     LSSAQAAQKL VADANAALGG LEVLVNNAGI TRDTLLIRMK DEDWDTVIAT NLSAIFHTTR       120
     EAIKLMMRAR WGRVINISSV VGILGNPGQA NYVAAKAGLI GFTKSVAKEY ATRGITVNAV       180
     APGFIESDMT AKLPEQVVAE YLKQIPAGRL GKPEEVAKAV AFLASDDAAY ITGQTLCVDG       240
     GMTPH                                                                   245
//

If you have problems or comments...

PBIL Back to PBIL home page