(data stored in ACNUC7421 zone)

EMBL: CP001743.PE65

CP001743.PE65        Location/Qualifiers
FT   CDS             56244..56522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0066"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ilo:IL2508 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26847"
FT                   /protein_id="ADD26847.1"
FT                   /translation="MITIHRSGQYRFYVNSGYNLEPPYICVKHEGHVAKFSLQPLALQS
FT                   NNGFSRTELSRIQQAVLDARDQLLKHWANVRGTEGEKPSGELLLHQE"
     MITIHRSGQY RFYVNSGYNL EPPYICVKHE GHVAKFSLQP LALQSNNGFS RTELSRIQQA        60
     VLDARDQLLK HWANVRGTEG EKPSGELLLH QE                                      92
//

If you have problems or comments...

PBIL Back to PBIL home page