(data stored in ACNUC7421 zone)

EMBL: CP001743.PE650

CP001743.PE650       Location/Qualifiers
FT   CDS             complement(645245..646165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0665"
FT                   /product="malonyl CoA-acyl carrier protein transacylase"
FT                   /note="COGs: COG0331 (acyl-carrier-protein)
FT                   S-malonyltransferase; InterPro IPR014043:IPR004410; KEGG:
FT                   mxa:MXAN_4771 malonyl CoA-acyl carrier protein
FT                   transacylase; PFAM: Acyl transferase; SPTR: A3XC60
FT                   Acyl-carrier-protein S-malonyltransferase; TIGRFAM: malonyl
FT                   CoA-acyl carrier protein transacylase; PFAM: Acyl
FT                   transferase domain; TIGRFAM: malonyl CoA-acyl carrier
FT                   protein transacylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27432"
FT                   /protein_id="ADD27432.1"
FT                   /translation="MIAALFPGQGSQEIGMGKALYEGSRAAREALDRAEAALPGLLKLM
FT                   WEGPEEELKLTANQQPALLAVGYAAFQAYLEMGGALPSFAAGHSLGEWTAHVAAGTLSL
FT                   EDGLRLVRKRGEYMQEAVPVGAGAMAAVLKVPAQTIQELTAGLAGVEVANYNSPEQTVI
FT                   SGTAEGVAKATEVLKGHKARVIPLPVSAPFHSSLMRPARERLAADLAQVELSTPRFPVY
FT                   SNVRAQPETRPSVIRELLLEQITHAVRWVEILQHLKAQGVKVYLEFGSGKVLTGLVGRT
FT                   LDGVEARSLTRPQEIAEYLAVLKQG"
     MIAALFPGQG SQEIGMGKAL YEGSRAAREA LDRAEAALPG LLKLMWEGPE EELKLTANQQ        60
     PALLAVGYAA FQAYLEMGGA LPSFAAGHSL GEWTAHVAAG TLSLEDGLRL VRKRGEYMQE       120
     AVPVGAGAMA AVLKVPAQTI QELTAGLAGV EVANYNSPEQ TVISGTAEGV AKATEVLKGH       180
     KARVIPLPVS APFHSSLMRP ARERLAADLA QVELSTPRFP VYSNVRAQPE TRPSVIRELL       240
     LEQITHAVRW VEILQHLKAQ GVKVYLEFGS GKVLTGLVGR TLDGVEARSL TRPQEIAEYL       300
     AVLKQG                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page