(data stored in ACNUC7421 zone)

EMBL: CP001743.PE651

CP001743.PE651       Location/Qualifiers
FT   CDS             complement(646191..647168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0666"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) synthase III"
FT                   /EC_number="2.3.1.180"
FT                   /EC_number="2.3.1.41"
FT                   /note="TIGRFAM: 3-oxoacyl-(acyl-carrier-protein) synthase
FT                   III; PRIAM: Beta-ketoacyl-acyl-carrier-protein synthase
FT                   III; PFAM: 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase
FT                   III domain protein; 3-Oxoacyl-[acyl-carrier-protein (ACP)]
FT                   synthase III; InterPro IPR013751:IPR013747:IPR004655; KEGG:
FT                   bcz:BCZK1071 3-oxoacyl-(acyl carrier protein) synthase III;
FT                   COGs: COG0332 3-oxoacyl-(acyl-carrier-protein); SPTR:
FT                   Q9RT23 3-oxoacyl-[acyl-carrier-protein] synthase 3 protein
FT                   1; PFAM: 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase
FT                   III; 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C
FT                   terminal; TIGRFAM: 3-oxoacyl-(acyl-carrier-protein)
FT                   synthase III"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27433"
FT                   /protein_id="ADD27433.1"
FT                   /translation="MNIGILALGTYAPERVMTNHDFEKILDTSDEWIVSRTGIRERRLA
FT                   AEGEFTSHLAFRAVEDLIRRHGRGALEGVDLVIVATNTPDALFPATAALVQDRFGLNAG
FT                   AYDLLAGCPGWGYAIAQAHAMVKSGLARKVLAIGSETLSKILDYTDRSTAVLFGDGAGA
FT                   AVIGPVPEGYGFKSFVLGADGSGGKELMLRCIADKLPDGSPMRQYAYMNGREVFKFAVR
FT                   VMNTATLEAIEKAGLKPEDIKYLIPHQANARIIEAARERLGLPPEQVWVNVDRYGNTST
FT                   ASMPIALQEALDAGKIHNGDHILFVTFGAGLTWAASVMTWWQPD"
     MNIGILALGT YAPERVMTNH DFEKILDTSD EWIVSRTGIR ERRLAAEGEF TSHLAFRAVE        60
     DLIRRHGRGA LEGVDLVIVA TNTPDALFPA TAALVQDRFG LNAGAYDLLA GCPGWGYAIA       120
     QAHAMVKSGL ARKVLAIGSE TLSKILDYTD RSTAVLFGDG AGAAVIGPVP EGYGFKSFVL       180
     GADGSGGKEL MLRCIADKLP DGSPMRQYAY MNGREVFKFA VRVMNTATLE AIEKAGLKPE       240
     DIKYLIPHQA NARIIEAARE RLGLPPEQVW VNVDRYGNTS TASMPIALQE ALDAGKIHNG       300
     DHILFVTFGA GLTWAASVMT WWQPD                                             325
//

If you have problems or comments...

PBIL Back to PBIL home page