(data stored in ACNUC7421 zone)

EMBL: CP001743.PE653

CP001743.PE653       Location/Qualifiers
FT   CDS             complement(647630..648388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0668"
FT                   /product="protein of unknown function DUF62"
FT                   /note="PFAM: protein of unknown function DUF62; SPTR:
FT                   A3IPF2 Putative uncharacterized protein; InterPro
FT                   IPR002747:IPR013838; COGs: COG1912 conserved hypothetical
FT                   protein; KEGG: sfu:Sfum_1405 protein of unknown function
FT                   DUF62; PFAM: Protein of unknown function DUF62"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0668"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27435"
FT                   /protein_id="ADD27435.1"
FT                   /translation="MREIFFLSDFGLADPYAAVVKAVMRQTAPGAVIHDLAHNLPPGDL
FT                   RRASYILYESVPYLPRQSVVLAVVDPGVGSSRRAVLVIGERLCYVAPDNGLLTLAYLQD
FT                   PPRKAYLLENPAYHLPRKSATFHGRDVFGPVAAHLASGVEPARFGPEVPVAELVRLPIH
FT                   LNFGNHGEVLTFDRFGNAITTLLATPAQVRGKKVRIRYHHIPVASHYAEVPVGSALAYV
FT                   GSAGLLEVAIHLGNAQEQLGLKQGDRVELG"
     MREIFFLSDF GLADPYAAVV KAVMRQTAPG AVIHDLAHNL PPGDLRRASY ILYESVPYLP        60
     RQSVVLAVVD PGVGSSRRAV LVIGERLCYV APDNGLLTLA YLQDPPRKAY LLENPAYHLP       120
     RKSATFHGRD VFGPVAAHLA SGVEPARFGP EVPVAELVRL PIHLNFGNHG EVLTFDRFGN       180
     AITTLLATPA QVRGKKVRIR YHHIPVASHY AEVPVGSALA YVGSAGLLEV AIHLGNAQEQ       240
     LGLKQGDRVE LG                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page