(data stored in ACNUC7421 zone)

EMBL: CP001743.PE655

CP001743.PE655       Location/Qualifiers
FT   CDS             650002..650757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0670"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: A4BH61 Putative uncharacterized protein;
FT                   InterPro IPR013026; KEGG: pol:Bpro_4026 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0670"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27437"
FT                   /protein_id="ADD27437.1"
FT                   /translation="MHIRYNPCDFVVGCVPLYREETVRSLVLVLMVLWSLALAQNVAAV
FT                   EKLVDDGKFQEAYEAGLRLGSAEGFVLAARAASYFAGYLAKDNEKADWFGRAEAAARRA
FT                   IQADADNAEAYFELARAQGRLSQYRGILESLGLASSIKENLDKALRLNPRHAGARVALA
FT                   LWHHSLISKNVGWLYGANGNQIMPLFNEAIQLEPQTIIHKVELAGVLAAQGKKEEARKQ
FT                   YEAALAIAPKTAADRFDLERARRELAALR"
     MHIRYNPCDF VVGCVPLYRE ETVRSLVLVL MVLWSLALAQ NVAAVEKLVD DGKFQEAYEA        60
     GLRLGSAEGF VLAARAASYF AGYLAKDNEK ADWFGRAEAA ARRAIQADAD NAEAYFELAR       120
     AQGRLSQYRG ILESLGLASS IKENLDKALR LNPRHAGARV ALALWHHSLI SKNVGWLYGA       180
     NGNQIMPLFN EAIQLEPQTI IHKVELAGVL AAQGKKEEAR KQYEAALAIA PKTAADRFDL       240
     ERARRELAAL R                                                            251
//

If you have problems or comments...

PBIL Back to PBIL home page