(data stored in ACNUC7421 zone)

EMBL: CP001743.PE658

CP001743.PE658       Location/Qualifiers
FT   CDS             complement(652614..653162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0673"
FT                   /product="serine O-acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /note="TIGRFAM: serine O-acetyltransferase; PFAM:
FT                   transferase hexapeptide repeat containing protein; InterPro
FT                   IPR001451:IPR005881; KEGG: pae:PA3816 O-acetylserine
FT                   synthase; COGs: COG1045 Serine acetyltransferase; SPTR:
FT                   A3LER7 O-acetylserine synthase; PFAM: Bacterial transferase
FT                   hexapeptide (three repeats); TIGRFAM: serine
FT                   O-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0673"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27440"
FT                   /protein_id="ADD27440.1"
FT                   /translation="MLRVIERFREDIQAVLERDPAARGPLEAFLFSPGMHALWMHRLNH
FT                   WLWRANFKLLARILAHFTRMFTGVEIHPGARIGRRVVIDHGMGIVIGETAEVGDDVLMY
FT                   HGVTLGGTGFTREKRHPTIGKGVLLGAHAVVLGPIVVGDGAKIGAGAVVTKPVPPGATA
FT                   IGNPAQIIVREEALEAAPA"
     MLRVIERFRE DIQAVLERDP AARGPLEAFL FSPGMHALWM HRLNHWLWRA NFKLLARILA        60
     HFTRMFTGVE IHPGARIGRR VVIDHGMGIV IGETAEVGDD VLMYHGVTLG GTGFTREKRH       120
     PTIGKGVLLG AHAVVLGPIV VGDGAKIGAG AVVTKPVPPG ATAIGNPAQI IVREEALEAA       180
     PA                                                                      182
//

If you have problems or comments...

PBIL Back to PBIL home page