(data stored in ACNUC7421 zone)

EMBL: CP001743.PE659

CP001743.PE659       Location/Qualifiers
FT   CDS             complement(653271..654008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0674"
FT                   /product="protein of unknown function DUF28"
FT                   /note="PFAM: protein of unknown function DUF28; SPTR:
FT                   Q5SK31 UPF0082 protein TTHA0821; InterPro IPR002876; COGs:
FT                   COG0217 conserved hypothetical protein; KEGG: glo:Glov_1245
FT                   protein of unknown function DUF28; PFAM: Domain of unknown
FT                   function DUF28; TIGRFAM: conserved hypothetical protein
FT                   TIGR01033"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0674"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27441"
FT                   /protein_id="ADD27441.1"
FT                   /translation="MAGHSKWAQIKRKKAANDLKKGKIVSKYLRLIAAAARAGGSTDPA
FT                   ANVNLRNLIEAARDADVPNDNIERLLKRLAGGDDEGSNYEEIVYEGYAPGGVAIIVQAL
FT                   SDNRNRTASEVRHIFNKHGGSLGATGSVSWQFERRGYIWVEPNSEAAQEAAIEAGAIDL
FT                   QESEEGLEIYTDPQEVYAVANALKAKGFKPEDTEITMVPQNTMSLSQEEAEKVLRMVEA
FT                   LEELDDVQNVYTNLNLDNVSIGA"
     MAGHSKWAQI KRKKAANDLK KGKIVSKYLR LIAAAARAGG STDPAANVNL RNLIEAARDA        60
     DVPNDNIERL LKRLAGGDDE GSNYEEIVYE GYAPGGVAII VQALSDNRNR TASEVRHIFN       120
     KHGGSLGATG SVSWQFERRG YIWVEPNSEA AQEAAIEAGA IDLQESEEGL EIYTDPQEVY       180
     AVANALKAKG FKPEDTEITM VPQNTMSLSQ EEAEKVLRMV EALEELDDVQ NVYTNLNLDN       240
     VSIGA                                                                   245
//

If you have problems or comments...

PBIL Back to PBIL home page