(data stored in ACNUC7421 zone)

EMBL: CP001743.PE662

CP001743.PE662       Location/Qualifiers
FT   CDS             656755..658035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0677"
FT                   /product="peptidase S41"
FT                   /note="COGs: COG0793 Periplasmic protease; InterPro
FT                   IPR001478:IPR005151; KEGG: mca:MCA2533 carboxyl-terminal
FT                   protease; SMART: PDZ/DHR/GLGF domain protein; peptidase
FT                   S41; SPTR: A4CSB8 Putative uncharacterized protein; PFAM:
FT                   peptidase S41; PDZ/DHR/GLGF domain protein; PFAM: PDZ
FT                   domain (Also known as DHR or GLGF); Peptidase family S41;
FT                   TIGRFAM: C-terminal peptidase (prc)"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0677"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27444"
FT                   /protein_id="ADD27444.1"
FT                   /translation="MRQLFATLALLLGSFSLASPAQDLFDQASFYLEFYYNGPATLNLK
FT                   ELTARYQSALDRACAPQKDTCPYEQAVPIIEQMLGELNDNHTYYLSPEELRGSRESRQG
FT                   NAPSRTLRIGVSHLPVPGSRDRLIVDVVEGGPADEAGLAYGDRIIAINGRLLSEFPDDN
FT                   QVVQFLTQSVQSGRPVVLTILRGPERQRLEITLTGREINLARFPSLKIRPDGVGVLKIP
FT                   NFDAQGQVGRRVHELVREAQQKNVRALVLELRGNSGGLLNEMILAAAAFLDDAYVALVD
FT                   RYQTERAEFRIRDGRLTIIRNGQTESANLPFLARWRGPLVVLVDGNTASGGEYLASAIQ
FT                   RAKVGPLVGVATLGIGNTTTRPFNLINGGALSISYNRAFFADGTPYPPRAIPDFVVESS
FT                   LEQLANTGRDLPFEKALEALGIKSAGR"
     MRQLFATLAL LLGSFSLASP AQDLFDQASF YLEFYYNGPA TLNLKELTAR YQSALDRACA        60
     PQKDTCPYEQ AVPIIEQMLG ELNDNHTYYL SPEELRGSRE SRQGNAPSRT LRIGVSHLPV       120
     PGSRDRLIVD VVEGGPADEA GLAYGDRIIA INGRLLSEFP DDNQVVQFLT QSVQSGRPVV       180
     LTILRGPERQ RLEITLTGRE INLARFPSLK IRPDGVGVLK IPNFDAQGQV GRRVHELVRE       240
     AQQKNVRALV LELRGNSGGL LNEMILAAAA FLDDAYVALV DRYQTERAEF RIRDGRLTII       300
     RNGQTESANL PFLARWRGPL VVLVDGNTAS GGEYLASAIQ RAKVGPLVGV ATLGIGNTTT       360
     RPFNLINGGA LSISYNRAFF ADGTPYPPRA IPDFVVESSL EQLANTGRDL PFEKALEALG       420
     IKSAGR                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page