(data stored in ACNUC7421 zone)

EMBL: CP001743.PE666

CP001743.PE666       Location/Qualifiers
FT   CDS             complement(660081..660770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0681"
FT                   /product="cytochrome c biogenesis protein transmembrane
FT                   region"
FT                   /note="PFAM: cytochrome c biogenesis protein transmembrane
FT                   region; SPTR: A3SRT8 CcdA, cytochrome c-type biogenesis
FT                   protein CdcA; InterPro IPR003834; COGs: COG0785 Cytochrome
FT                   c biogenesis protein; KEGG: maq:Maqu_3250 cytochrome c
FT                   biogenesis protein, transmembrane region; PFAM: Cytochrome
FT                   C biogenesis protein transmembrane region"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0681"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27448"
FT                   /protein_id="ADD27448.1"
FT                   /translation="MAAMSVVAAFLAGILSFLSPCVLPLVPTYLLYLGGERGRPLLNAL
FT                   FFVGGFSLLFLLLGLPFTLLGSFLSENRQLLGQAGGAILVLLGLYMLGLKPQWGVNLRY
FT                   QGDTSRPWGAFVLGAVLGLGWTPCIGPILGGILTLTAAGGGINSLLAYILGLAVPFLLV
FT                   ALLTDRIRPVLRQAARFSRWAEAVAGVALVAMGILMFTGTFTRLNSFFIKITPERLLNL
FT                   EKILIGQ"
     MAAMSVVAAF LAGILSFLSP CVLPLVPTYL LYLGGERGRP LLNALFFVGG FSLLFLLLGL        60
     PFTLLGSFLS ENRQLLGQAG GAILVLLGLY MLGLKPQWGV NLRYQGDTSR PWGAFVLGAV       120
     LGLGWTPCIG PILGGILTLT AAGGGINSLL AYILGLAVPF LLVALLTDRI RPVLRQAARF       180
     SRWAEAVAGV ALVAMGILMF TGTFTRLNSF FIKITPERLL NLEKILIGQ                   229
//

If you have problems or comments...

PBIL Back to PBIL home page