(data stored in ACNUC7421 zone)

EMBL: CP001743.PE667

CP001743.PE667       Location/Qualifiers
FT   CDS             660835..661848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0682"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   InterPro IPR003439:IPR003593:IPR017871; KEGG: pmy:Pmen_1328
FT                   ABC transporter related; COGs: COG3842 ABC-type
FT                   spermidine/putrescine transport systems ATPase components;
FT                   SPTR: Q8U0R5 Sugar-binding transport ATP-binding protein;
FT                   PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0682"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27449"
FT                   /protein_id="ADD27449.1"
FT                   /translation="MLRVIGLGKSYPGFRLQVSLEVGVGQTLALLGPSGSGKSTLLRLI
FT                   AGLEAPEVGQVWLEQTELTPLAPEARRVGFVFQDYALFPHLSVWENIAFGLREARWDGA
FT                   SIRRRVAELLDLTHLGPHAQKRPNQLSGGERQRVALARALANRPRLLLLDEPLGALDLK
FT                   LRHELLWELRAILRQAGVPTIVVTHDQSEAFVIAQQIALLRGGAVVQVGSPEQLFRHPK
FT                   NAWVAGFLGHRNLLSADQSQQMGLPARPHLLPPEAITLGQGEEARVEERVFKGFVVGLE
FT                   LLWRGCKLYLEGPELGLYPGDTTQLGIDWSRVVALEEEPSSTPGAAQPSLEAPRAR"
     MLRVIGLGKS YPGFRLQVSL EVGVGQTLAL LGPSGSGKST LLRLIAGLEA PEVGQVWLEQ        60
     TELTPLAPEA RRVGFVFQDY ALFPHLSVWE NIAFGLREAR WDGASIRRRV AELLDLTHLG       120
     PHAQKRPNQL SGGERQRVAL ARALANRPRL LLLDEPLGAL DLKLRHELLW ELRAILRQAG       180
     VPTIVVTHDQ SEAFVIAQQI ALLRGGAVVQ VGSPEQLFRH PKNAWVAGFL GHRNLLSADQ       240
     SQQMGLPARP HLLPPEAITL GQGEEARVEE RVFKGFVVGL ELLWRGCKLY LEGPELGLYP       300
     GDTTQLGIDW SRVVALEEEP SSTPGAAQPS LEAPRAR                                337
//

If you have problems or comments...

PBIL Back to PBIL home page