(data stored in ACNUC7421 zone)

EMBL: CP001743.PE669

CP001743.PE669       Location/Qualifiers
FT   CDS             complement(662476..662973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0684"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0684"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27451"
FT                   /protein_id="ADD27451.1"
FT                   /translation="MDPFREYQDYVIAHRLREALDFFPGKLYSLCEYATLRLRRSELVR
FT                   KLVGRQGDPALLSRIEQISDEINFGFWSNPGLLKAFLKRLPPQQYPVLHSPEAFETLLS
FT                   HTERLRLKEPGLAGRYYLGWLRLPALLDEPSAFEQAMLEQEHLAEALGLFLDEFHKVAG
FT                   SG"
     MDPFREYQDY VIAHRLREAL DFFPGKLYSL CEYATLRLRR SELVRKLVGR QGDPALLSRI        60
     EQISDEINFG FWSNPGLLKA FLKRLPPQQY PVLHSPEAFE TLLSHTERLR LKEPGLAGRY       120
     YLGWLRLPAL LDEPSAFEQA MLEQEHLAEA LGLFLDEFHK VAGSG                       165
//

If you have problems or comments...

PBIL Back to PBIL home page