(data stored in ACNUC7421 zone)

EMBL: CP001743.PE671

CP001743.PE671       Location/Qualifiers
FT   CDS             663366..664541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0686"
FT                   /product="peptidase M28"
FT                   /note="PFAM: peptidase M28; protease-associated PA domain
FT                   protein; peptidase M20; SPTR: A2V759 Aminopeptidase;
FT                   InterPro IPR003137:IPR007484:IPR002933; COGs: COG2234
FT                   aminopeptidase; KEGG: bha:BH3861 aminopeptidase; PFAM:
FT                   Peptidase family M20/M25/M40; PA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0686"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27453"
FT                   /protein_id="ADD27453.1"
FT                   /translation="MGRQLFLRGALGLVAIGLLALAQAFSTERMQADLQALLSQGPRVA
FT                   GLPATTAAGEYLAAELRKVGYTVEFQPFTYSRTRDQGSSLLVGTTSFPVSSVAGSPGRR
FT                   VEGPLAVVPGAGLAADFADLNLQGAIAVVRRGGIPGLEKARLAAERGAVGLILLTEEPS
FT                   GTRFTFGGNSPIPGVTLSQSDGAGLFSQAGTRAVLDVRIVTEEVQGRNVIARRSSQNPL
FT                   VIVGAHYDSVPGSPGANDNASGTVTVLELARQLADSPLAAQIWFLFFDGEEDGLWGSRR
FT                   FVEQNPEIVRGLKGMLNLDMVGVNVNGTLGIGGSGELRALADCNALQVACGSAPGGGSD
FT                   HVPFAQAGVPVLFFFRGLDPNYHRPTDTLADPVLMAQTGQVVRGILERLLR"
     MGRQLFLRGA LGLVAIGLLA LAQAFSTERM QADLQALLSQ GPRVAGLPAT TAAGEYLAAE        60
     LRKVGYTVEF QPFTYSRTRD QGSSLLVGTT SFPVSSVAGS PGRRVEGPLA VVPGAGLAAD       120
     FADLNLQGAI AVVRRGGIPG LEKARLAAER GAVGLILLTE EPSGTRFTFG GNSPIPGVTL       180
     SQSDGAGLFS QAGTRAVLDV RIVTEEVQGR NVIARRSSQN PLVIVGAHYD SVPGSPGAND       240
     NASGTVTVLE LARQLADSPL AAQIWFLFFD GEEDGLWGSR RFVEQNPEIV RGLKGMLNLD       300
     MVGVNVNGTL GIGGSGELRA LADCNALQVA CGSAPGGGSD HVPFAQAGVP VLFFFRGLDP       360
     NYHRPTDTLA DPVLMAQTGQ VVRGILERLL R                                      391
//

If you have problems or comments...

PBIL Back to PBIL home page