(data stored in ACNUC7421 zone)

EMBL: CP001743.PE672

CP001743.PE672       Location/Qualifiers
FT   CDS             complement(664548..665462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0687"
FT                   /product="Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit"
FT                   /note="PFAM: Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit; SPTR: B3LQP1 Putative uncharacterized protein;
FT                   InterPro IPR001926:IPR000634; COGs: COG1171 Threonine
FT                   dehydratase; KEGG: aav:Aave_3217
FT                   pyridoxal-5'-phosphate-dependent enzyme, beta subunit;
FT                   PFAM: Pyridoxal-phosphate dependent enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0687"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27454"
FT                   /protein_id="ADD27454.1"
FT                   /translation="MLTLQDIQHAAQRIAPYIHHTPVLSSQGLDKLLGRRFFFKAEHLQ
FT                   KTGSFKARGALNAALQLQNPRGLIAVSSGNHAQGVAYAAQVIGAPALVVMPEDASPTKK
FT                   AATRAYGAEVYDQGVTVENREQVVRALAEETGYALIHPFDDLRVMAGQGTQALELLQQV
FT                   PDLDAVLVAVGGGGLISGIATVIKSLRPACEVIGVEPETANDAQQSLQMGARVKLVQAP
FT                   RTVADGVRTLAVGEKTFPVMQRHVDRIVTVPDEVTLEAQRLMMQRLKQVVEPTAGLALG
FT                   PALMSYDLPERVAVIVCGGNWMP"
     MLTLQDIQHA AQRIAPYIHH TPVLSSQGLD KLLGRRFFFK AEHLQKTGSF KARGALNAAL        60
     QLQNPRGLIA VSSGNHAQGV AYAAQVIGAP ALVVMPEDAS PTKKAATRAY GAEVYDQGVT       120
     VENREQVVRA LAEETGYALI HPFDDLRVMA GQGTQALELL QQVPDLDAVL VAVGGGGLIS       180
     GIATVIKSLR PACEVIGVEP ETANDAQQSL QMGARVKLVQ APRTVADGVR TLAVGEKTFP       240
     VMQRHVDRIV TVPDEVTLEA QRLMMQRLKQ VVEPTAGLAL GPALMSYDLP ERVAVIVCGG       300
     NWMP                                                                    304
//

If you have problems or comments...

PBIL Back to PBIL home page