(data stored in ACNUC7421 zone)

EMBL: CP001743.PE674

CP001743.PE674       Location/Qualifiers
FT   CDS             666060..667382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0689"
FT                   /product="RNA modification enzyme, MiaB family"
FT                   /note="TIGRFAM: RNA modification enzyme, MiaB family; PFAM:
FT                   Protein of unknown function UPF0004 ; Radical SAM domain
FT                   protein; SMART: Elongator protein 3/MiaB/NifB;
FT                   InterProIPR007197:IPR013848:IPR006638:IPR002792:IPR 005839;
FT                   KEGG: gsu:GSU2568 MiaB-like tRNA modifying enzyme; COGs:
FT                   COG0621 2-methylthioadenine synthetase; SPTR: A1HR14 RNA
FT                   modification enzyme, MiaB family; PFAM: Radical SAM
FT                   superfamily; Uncharacterized protein family UPF0004;
FT                   TIGRFAM: RNA modification enzyme, MiaB family; MiaB-like
FT                   tRNA modifying enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0689"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27456"
FT                   /protein_id="ADD27456.1"
FT                   /translation="MPLMEGVRLAVKTLGCKVNQVESDALVGLLKPLQPVVVPLEAGAD
FT                   LVVINTCAVTTSAEADARKEVRRARRANPAAFIVVTGCYAELAPDQLAELGADVVLPNS
FT                   RKAELPGVILQRFGLPADPITTPPNEFWGAGERGLLNNYVRAFLKVQDGCNAGCAYCII
FT                   PRLRGRERHRGYRDALSEAGALLEAGVQEIVLTGVRLGSYKGHPRGIAGLVEELALMGA
FT                   KVRLSSIEPEDTGDELLRVMQRFAPQVRPHLHLSLQTGSGRLLALMGRRYDKNYYRELA
FT                   QKAYDWIPGFALTTDVIAGLPTETEDEHQETLAFLEEVRPSRVHVFTYTPRPKTRAASL
FT                   PQVPIEIRKRRNKELQALAARLAEARVRPKLGGAVEVLVESFRGGKAYGHTPDYYEVEF
FT                   TGQARIGQTAWVRVEAIEGYTLRGALEAIKQEPARYLLPVV"
     MPLMEGVRLA VKTLGCKVNQ VESDALVGLL KPLQPVVVPL EAGADLVVIN TCAVTTSAEA        60
     DARKEVRRAR RANPAAFIVV TGCYAELAPD QLAELGADVV LPNSRKAELP GVILQRFGLP       120
     ADPITTPPNE FWGAGERGLL NNYVRAFLKV QDGCNAGCAY CIIPRLRGRE RHRGYRDALS       180
     EAGALLEAGV QEIVLTGVRL GSYKGHPRGI AGLVEELALM GAKVRLSSIE PEDTGDELLR       240
     VMQRFAPQVR PHLHLSLQTG SGRLLALMGR RYDKNYYREL AQKAYDWIPG FALTTDVIAG       300
     LPTETEDEHQ ETLAFLEEVR PSRVHVFTYT PRPKTRAASL PQVPIEIRKR RNKELQALAA       360
     RLAEARVRPK LGGAVEVLVE SFRGGKAYGH TPDYYEVEFT GQARIGQTAW VRVEAIEGYT       420
     LRGALEAIKQ EPARYLLPVV                                                   440
//

If you have problems or comments...

PBIL Back to PBIL home page