(data stored in ACNUC7421 zone)

EMBL: CP001743.PE679

CP001743.PE679       Location/Qualifiers
FT   CDS             669434..669976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0694"
FT                   /product="phosphoribosyltransferase"
FT                   /note="PFAM: phosphoribosyltransferase; SPTR: A5TS89
FT                   Adenine phosphoribosyltransferase; InterPro IPR000836;
FT                   COGs: COG0503 Adenine/guanine phosphoribosyltransferase and
FT                   related PRPP-binding protein; KEGG: afr:AFE_0540 adenine
FT                   phosphoribosyltransferase, putative; PFAM: Phosphoribosyl
FT                   transferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0694"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27461"
FT                   /protein_id="ADD27461.1"
FT                   /translation="MTVKTYAVEVAGVRRELPVVQVGPDVAVALFNMLGDTEVVEEAAA
FT                   ALAKRMPAEIETLVTPEVKAVPLAHALSRLTGKPYVVARKTEKPYMINPVSRTVISITT
FT                   GKPQLLVLDGTDVPLIKGKKVAIVDDVVSTGSTLKGLSDLITDVGGQVAAVLAVFTEGS
FT                   PREDVIALGHLPLFKPD"
     MTVKTYAVEV AGVRRELPVV QVGPDVAVAL FNMLGDTEVV EEAAAALAKR MPAEIETLVT        60
     PEVKAVPLAH ALSRLTGKPY VVARKTEKPY MINPVSRTVI SITTGKPQLL VLDGTDVPLI       120
     KGKKVAIVDD VVSTGSTLKG LSDLITDVGG QVAAVLAVFT EGSPREDVIA LGHLPLFKPD       180
//

If you have problems or comments...

PBIL Back to PBIL home page