(data stored in ACNUC7421 zone)

EMBL: CP001743.PE680

CP001743.PE680       Location/Qualifiers
FT   CDS             670122..670658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0695"
FT                   /product="phosphoribosyltransferase"
FT                   /note="PFAM: phosphoribosyltransferase; SPTR: A5TS89
FT                   Adenine phosphoribosyltransferase; InterPro IPR000836;
FT                   COGs: COG0503 Adenine/guanine phosphoribosyltransferase and
FT                   related PRPP-binding protein; KEGG: dps:DP1516 adenine
FT                   phosphoribosyltransferase; PFAM: Phosphoribosyl transferase
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0695"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27462"
FT                   /protein_id="ADD27462.1"
FT                   /translation="METYPITIGKITRHVPVVETLPGVHIPLVEIMGDVELVQAAAEGL
FT                   VKHLPPETDALLTLETSPIVLAHTMSALCGKPYVVVRRKRRPYMQDPIIQEVESLTLGV
FT                   TETLWLDSRMAEKLMGQNVALVFDVVSSGGTMNALEKVAKKAGANVVARLAAFHQGNSK
FT                   LPITFLSEIPILQTA"
     METYPITIGK ITRHVPVVET LPGVHIPLVE IMGDVELVQA AAEGLVKHLP PETDALLTLE        60
     TSPIVLAHTM SALCGKPYVV VRRKRRPYMQ DPIIQEVESL TLGVTETLWL DSRMAEKLMG       120
     QNVALVFDVV SSGGTMNALE KVAKKAGANV VARLAAFHQG NSKLPITFLS EIPILQTA         178
//

If you have problems or comments...

PBIL Back to PBIL home page