(data stored in ACNUC7421 zone)

EMBL: CP001743.PE681

CP001743.PE681       Location/Qualifiers
FT   CDS             complement(670726..671382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0696"
FT                   /product="phospholipase/Carboxylesterase"
FT                   /note="PFAM: phospholipase/Carboxylesterase; SPTR: A6C3M0
FT                   Putative uncharacterized protein; InterPro IPR003140; COGs:
FT                   COG4099 peptidase; KEGG: sml:Smlt1102 hypothetical protein;
FT                   PFAM: Phospholipase/Carboxylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0696"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27463"
FT                   /protein_id="ADD27463.1"
FT                   /translation="MNPFSYHKPRSQLPYALYLPAGKPPKGGWPLILFLHGSGERGSDG
FT                   RKQSTVGLGPAIQENPQRWPAVVLMPQCPKGQQWAGEPLAQAYELLHQVEQEHQTNPRR
FT                   VYLTGLSMGGYGSWNLGGLYPRRFAAIAPICGAADPFMVWQRLGKVPIWNFHGAADEVV
FT                   PVSFSRALADALAKAGNTRARFTEYPSEKHDVWNRVYRELEFIQWLFAQQKRGGS"
     MNPFSYHKPR SQLPYALYLP AGKPPKGGWP LILFLHGSGE RGSDGRKQST VGLGPAIQEN        60
     PQRWPAVVLM PQCPKGQQWA GEPLAQAYEL LHQVEQEHQT NPRRVYLTGL SMGGYGSWNL       120
     GGLYPRRFAA IAPICGAADP FMVWQRLGKV PIWNFHGAAD EVVPVSFSRA LADALAKAGN       180
     TRARFTEYPS EKHDVWNRVY RELEFIQWLF AQQKRGGS                               218
//

If you have problems or comments...

PBIL Back to PBIL home page