(data stored in ACNUC7421 zone)

EMBL: CP001743.PE683

CP001743.PE683       Location/Qualifiers
FT   CDS             complement(671816..673471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0698"
FT                   /product="methylmalonyl-CoA mutase, large subunit"
FT                   /EC_number="5.4.99.2"
FT                   /note="TIGRFAM: methylmalonyl-CoA mutase, large subunit;
FT                   PRIAM: Methylmalonyl-CoA mutase; PFAM: methylmalonyl-CoA
FT                   mutase; InterPro IPR006099:IPR006098; KEGG:
FT                   aba:Acid345_1454 methylmalonyl-CoA mutase; COGs: COG1884
FT                   Methylmalonyl-CoA mutase N-terminal domain/subunit; SPTR:
FT                   B5ISK6 Methylmalonyl-CoA mutase N-terminal domain
FT                   subfamily; PFAM: Methylmalonyl-CoA mutase; TIGRFAM:
FT                   methylmalonyl-CoA mutase N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0698"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27465"
FT                   /protein_id="ADD27465.1"
FT                   /translation="MAQPRPKHAWMRETYQKSLAKMPERKVAHKTLSDIAPEPLYTPED
FT                   LQDFDYAEKLGYPGEYPYTRGVYGSMYRSRLWTMRMFAGFGTAEQTNERFKKLLAAGQN
FT                   GLSTAFDLPTLMGYDSDHPLSKGEVGKCGVAVSSLADMEILFEGINLEEVTTSMTINSP
FT                   ANAIWAMYLAAAKKKGYDWNKLGGTIQNDILKEFIAQKEFIFPPEPSTKLVIDTFEWGP
FT                   RNVPKWNFISVSGYHIREAGSTAVQELAYTLADGFEYVEWALKRGLEIDEFAPRISFFF
FT                   NAHNDFFEEICKFRAARRIWAKEMRHRYGAKNPQSWMLRTHAQTAGVSLTAQQPLINIA
FT                   RVAIQALAAVLGGTNSLHTDAYDEALALPTEESAKIALRTQQIIAYESGVTHTADPLGG
FT                   SYYVEWLTDQMEAQAMQIIEEIRRMGGVVRAIEEGYFLREIADASYRFQQEVERGERII
FT                   VGVNAFQDEGLQVPIQLIDPEVERVQAERLAQVRRQRDPQAVQQALAALRQAAKEGRNT
FT                   MPYFVDCALAYCTLGEMMDELRAVYGVYEEPVLV"
     MAQPRPKHAW MRETYQKSLA KMPERKVAHK TLSDIAPEPL YTPEDLQDFD YAEKLGYPGE        60
     YPYTRGVYGS MYRSRLWTMR MFAGFGTAEQ TNERFKKLLA AGQNGLSTAF DLPTLMGYDS       120
     DHPLSKGEVG KCGVAVSSLA DMEILFEGIN LEEVTTSMTI NSPANAIWAM YLAAAKKKGY       180
     DWNKLGGTIQ NDILKEFIAQ KEFIFPPEPS TKLVIDTFEW GPRNVPKWNF ISVSGYHIRE       240
     AGSTAVQELA YTLADGFEYV EWALKRGLEI DEFAPRISFF FNAHNDFFEE ICKFRAARRI       300
     WAKEMRHRYG AKNPQSWMLR THAQTAGVSL TAQQPLINIA RVAIQALAAV LGGTNSLHTD       360
     AYDEALALPT EESAKIALRT QQIIAYESGV THTADPLGGS YYVEWLTDQM EAQAMQIIEE       420
     IRRMGGVVRA IEEGYFLREI ADASYRFQQE VERGERIIVG VNAFQDEGLQ VPIQLIDPEV       480
     ERVQAERLAQ VRRQRDPQAV QQALAALRQA AKEGRNTMPY FVDCALAYCT LGEMMDELRA       540
     VYGVYEEPVL V                                                            551
//

If you have problems or comments...

PBIL Back to PBIL home page