(data stored in ACNUC7421 zone)

EMBL: CP001743.PE70

CP001743.PE70        Location/Qualifiers
FT   CDS             complement(58917..59963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0071"
FT                   /product="Agmatine deiminase"
FT                   /EC_number="3.5.3.12"
FT                   /note="PRIAM: Agmatine deiminase; PFAM: Porphyromonas-type
FT                   peptidyl-arginine deiminase; InterPro IPR007466; KEGG:
FT                   sat:SYN_02393 peptidylarginine deiminase related enzyme;
FT                   COGs: COG2957 Peptidylarginine deiminase; SPTR: A3HZY5
FT                   Peptidylarginine deiminase related enzyme; PFAM:
FT                   Porphyromonas-type peptidyl-arginine deiminase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26852"
FT                   /protein_id="ADD26852.1"
FT                   /translation="MENLTPRALGFRMPAEWAPHAATWTAWPYDEEKWLGYLEPVRQEF
FT                   AAFVNTLARFEPVHLVLHDEESERDARQRLAGPITFHRIPHDDLWLRDSGAIFVTRTPP
FT                   SGPVEVAAVNWEFNGWGGKYPAQQDNQMPLQMARILGMGLFEAGIVMEGGSLEVNGQGV
FT                   GLTTRQCLLSPARNPGLDEEALEGYLQQFLGIEHLIWLGNGLEGDHTDGHIDTLTRFAS
FT                   PYTIVTAVCPDPDDPNHRPLQENLEILRSLGGFRIVELPLPKNPLWLDSETRLPLTYAN
FT                   FYIANGAVLVPIYGDPHDEQALEILRPLFPGREVIGLQSRYLITGGGSFHCVTQQQPAG
FT                   AIWPGQTR"
     MENLTPRALG FRMPAEWAPH AATWTAWPYD EEKWLGYLEP VRQEFAAFVN TLARFEPVHL        60
     VLHDEESERD ARQRLAGPIT FHRIPHDDLW LRDSGAIFVT RTPPSGPVEV AAVNWEFNGW       120
     GGKYPAQQDN QMPLQMARIL GMGLFEAGIV MEGGSLEVNG QGVGLTTRQC LLSPARNPGL       180
     DEEALEGYLQ QFLGIEHLIW LGNGLEGDHT DGHIDTLTRF ASPYTIVTAV CPDPDDPNHR       240
     PLQENLEILR SLGGFRIVEL PLPKNPLWLD SETRLPLTYA NFYIANGAVL VPIYGDPHDE       300
     QALEILRPLF PGREVIGLQS RYLITGGGSF HCVTQQQPAG AIWPGQTR                    348
//

If you have problems or comments...

PBIL Back to PBIL home page