(data stored in ACNUC7421 zone)

EMBL: CP001743.PE71

CP001743.PE71        Location/Qualifiers
FT   CDS             complement(59993..61099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0072"
FT                   /product="Cys/Met metabolism pyridoxal-phosphate-dependent
FT                   protein"
FT                   /note="PFAM: Cys/Met metabolism
FT                   pyridoxal-phosphate-dependent protein; SPTR: A3TR96
FT                   Putative L,L-Cystathionine gamma-Lyase; InterPro IPR000277;
FT                   COGs: COG0626 Cystathionine beta-lyase/cystathionine
FT                   gamma-synthase; KEGG: pol:Bpro_2831 cystathionine
FT                   gamma-lyase; PFAM: Cys/Met metabolism PLP-dependent enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26853"
FT                   /protein_id="ADD26853.1"
FT                   /translation="MDKPSRLRPASWLVAAGRPTAPGEPLNTPLVPASNFILGQERAYA
FT                   RDGGTPTWEALEALVGGLEDGKAVAFASGMAAVAAVFDQLPVGALVVLPDDCYQGVVGL
FT                   ALAGAEKKRWSVRRLALEDTEGWVRACGEADLIWLESPSNPLLTVVDLAAIGQAPRKPG
FT                   AILAVDNTFATPLNQQPLAFGATVSIQSATKFIGGHSDLLGGVATTRDEALWQALRKSR
FT                   ELSGATPGTLEAFLAVRGARTLALRLQKAQENAQTLALRLEQHPRVARVRYPGLPSHPT
FT                   HATARRVLKGFGSIISFELHGGAAEADAVCRRVRLIRHATSLGGVESTMERRAAIPGQE
FT                   HLPPSLLRLSVGIEDVEDLWADLEAALQ"
     MDKPSRLRPA SWLVAAGRPT APGEPLNTPL VPASNFILGQ ERAYARDGGT PTWEALEALV        60
     GGLEDGKAVA FASGMAAVAA VFDQLPVGAL VVLPDDCYQG VVGLALAGAE KKRWSVRRLA       120
     LEDTEGWVRA CGEADLIWLE SPSNPLLTVV DLAAIGQAPR KPGAILAVDN TFATPLNQQP       180
     LAFGATVSIQ SATKFIGGHS DLLGGVATTR DEALWQALRK SRELSGATPG TLEAFLAVRG       240
     ARTLALRLQK AQENAQTLAL RLEQHPRVAR VRYPGLPSHP THATARRVLK GFGSIISFEL       300
     HGGAAEADAV CRRVRLIRHA TSLGGVESTM ERRAAIPGQE HLPPSLLRLS VGIEDVEDLW       360
     ADLEAALQ                                                                368
//

If you have problems or comments...

PBIL Back to PBIL home page