(data stored in ACNUC7421 zone)

EMBL: CP001743.PE75

CP001743.PE75        Location/Qualifiers
FT   CDS             complement(63020..64444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0076"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, B subunit"
FT                   /note="SPTR: Q72H75 Aspartyl/glutamyl-tRNA(Asn/Gln)
FT                   amidotransferase subunit B; KEGG: afw:Anae109_4336
FT                   aspartyl/glutamyl-tRNA amidotransferase subunit B; PFAM:
FT                   GatB region; GatB/Yqey domain protein; GatB central domain
FT                   protein; InterPro IPR006075:IPR003789:IPR006107:IPR004413;
FT                   TIGRFAM: glutamyl-tRNA(Gln) amidotransferase, B subunit;
FT                   COGs: COG0064 Asp-tRNAAsn/Glu-tRNAGln amidotransferase B
FT                   subunit (PET112 homolog); PFAM: PET112 family, C terminal
FT                   region; PET112 family, N terminal region; GatB domain;
FT                   TIGRFAM: glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn)
FT                   amidotransferase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26857"
FT                   /protein_id="ADD26857.1"
FT                   /translation="MPDFEAVVGLEVHLHLKTKSKMFCGCDASYFGDPPNTHTCPVCLG
FT                   LPGVLPVVNAQAVEYGILFGLALNCQIAPWTQFHRKSYYYPDMPKNYQISQYDLPIAAH
FT                   GYLEVEGQRVRIKRVHLEEDAAKSTHPEGASYSLIDLNRAGSPLIEMVTEPDIRTPEQA
FT                   RVFLSHIRSIAQTLGVSDANPEEGKMRADVNVSVRRVGEPLGTKVEIKNLNSFRSVARA
FT                   LEYEIRRQQEILRSGRRVEQATLGFDEAAGKTYVMRLKEGEADYRYFPDPDLPPIVVDE
FT                   AWLERLRAAMPELPAQKYARYVEAGVRPYDAEILAYNPSLARFFDQTLAHHQGNPQTVA
FT                   NLLNAEVAGYLNERLVEVQETALTPQHLAALAGLFERREITNRVLSQLLPEVMEGADPL
FT                   KLVEERGLRAVADEGALRPLVERVVAANPKVVEQVKGGNLKAANALLGPIMKETKGTAK
FT                   ADVVKKMLGEMLGVEL"
     MPDFEAVVGL EVHLHLKTKS KMFCGCDASY FGDPPNTHTC PVCLGLPGVL PVVNAQAVEY        60
     GILFGLALNC QIAPWTQFHR KSYYYPDMPK NYQISQYDLP IAAHGYLEVE GQRVRIKRVH       120
     LEEDAAKSTH PEGASYSLID LNRAGSPLIE MVTEPDIRTP EQARVFLSHI RSIAQTLGVS       180
     DANPEEGKMR ADVNVSVRRV GEPLGTKVEI KNLNSFRSVA RALEYEIRRQ QEILRSGRRV       240
     EQATLGFDEA AGKTYVMRLK EGEADYRYFP DPDLPPIVVD EAWLERLRAA MPELPAQKYA       300
     RYVEAGVRPY DAEILAYNPS LARFFDQTLA HHQGNPQTVA NLLNAEVAGY LNERLVEVQE       360
     TALTPQHLAA LAGLFERREI TNRVLSQLLP EVMEGADPLK LVEERGLRAV ADEGALRPLV       420
     ERVVAANPKV VEQVKGGNLK AANALLGPIM KETKGTAKAD VVKKMLGEML GVEL             474
//

If you have problems or comments...

PBIL Back to PBIL home page