(data stored in ACNUC7421 zone)

EMBL: CP001743.PE8

CP001743.PE8         Location/Qualifiers
FT   CDS             8087..8410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0008"
FT                   /product="branched-chain amino acid transport"
FT                   /note="PFAM: branched-chain amino acid transport; SPTR:
FT                   A7D5P4 Branched-chain amino acid transport; KEGG:
FT                   pmy:Pmen_3294 branched-chain amino acid transport; COGs:
FT                   COG4392 membrane protein; InterPro IPR008407; PFAM:
FT                   Branched-chain amino acid transport protein (AzlD)"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26790"
FT                   /protein_id="ADD26790.1"
FT                   /translation="MTSLDIWLNILGLALIAFAVRYYPMALLERFRLPPLVRQGLRYVP
FT                   AATLAGLVFPALLTHNGRWAGLAHPELWAGLVAALVAWRFKNALLTIGVGLLALWLLRS
FT                   VGL"
     MTSLDIWLNI LGLALIAFAV RYYPMALLER FRLPPLVRQG LRYVPAATLA GLVFPALLTH        60
     NGRWAGLAHP ELWAGLVAAL VAWRFKNALL TIGVGLLALW LLRSVGL                     107
//

If you have problems or comments...

PBIL Back to PBIL home page