(data stored in ACNUC7421 zone)

EMBL: CP001743.PE80

CP001743.PE80        Location/Qualifiers
FT   CDS             complement(67303..67581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0081"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26862"
FT                   /protein_id="ADD26862.1"
FT                   /translation="MDAKTLVLLAVGGVLVYFGWKALGQPQAQTDPAEPDNQQQEQPGS
FT                   GWNDGWNPDYQNPGGGAPGFGYGSFSNPCAIFPSLCRPSTPLGGYEI"
     MDAKTLVLLA VGGVLVYFGW KALGQPQAQT DPAEPDNQQQ EQPGSGWNDG WNPDYQNPGG        60
     GAPGFGYGSF SNPCAIFPSL CRPSTPLGGY EI                                      92
//

If you have problems or comments...

PBIL Back to PBIL home page