(data stored in ACNUC7421 zone)

EMBL: CP001743.PE82

CP001743.PE82        Location/Qualifiers
FT   CDS             complement(67762..68403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0083"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: GH10367 gene product from transcript
FT                   GH10367-RA"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26864"
FT                   /protein_id="ADD26864.1"
FT                   /translation="MKPIEVFAVVGAGGLAAFGLYTYARSRPKAEETVPGIPPQVPTHP
FT                   GVSGQERTSLCQVLTGYRSKLKEYEDLRADAEKKMRDLESLAQGNCRSYAQDPTFQYHC
FT                   NGFPICGINEWWTVSGTQTNQDAYNACMTFLQAGGGLEQRKHPKKEGSSWDDTWADIDR
FT                   INSQIGAAYNQVQNLRNQYQEAQRQAEEARQQINNLRRRIADLEAQGVFC"
     MKPIEVFAVV GAGGLAAFGL YTYARSRPKA EETVPGIPPQ VPTHPGVSGQ ERTSLCQVLT        60
     GYRSKLKEYE DLRADAEKKM RDLESLAQGN CRSYAQDPTF QYHCNGFPIC GINEWWTVSG       120
     TQTNQDAYNA CMTFLQAGGG LEQRKHPKKE GSSWDDTWAD IDRINSQIGA AYNQVQNLRN       180
     QYQEAQRQAE EARQQINNLR RRIADLEAQG VFC                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page