(data stored in ACNUC7421 zone)

EMBL: CP001743.PE83

CP001743.PE83        Location/Qualifiers
FT   CDS             complement(68390..68731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0084"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26865"
FT                   /protein_id="ADD26865.1"
FT                   /translation="MELLGFLGSALGGLFGFLGEDRKARAIEEAARAQVQTSRNLVDGA
FT                   IAQWAELRRAEEAKAAAQRDLGYWQEDTQRTRIYYNYQAARSGQAALLLVTGAGLLGVI
FT                   LWRLGREAD"
     MELLGFLGSA LGGLFGFLGE DRKARAIEEA ARAQVQTSRN LVDGAIAQWA ELRRAEEAKA        60
     AAQRDLGYWQ EDTQRTRIYY NYQAARSGQA ALLLVTGAGL LGVILWRLGR EAD              113
//

If you have problems or comments...

PBIL Back to PBIL home page