(data stored in ACNUC7421 zone)

EMBL: CP001743.PE84

CP001743.PE84        Location/Qualifiers
FT   CDS             complement(68733..69071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0085"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Q859S6 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26866"
FT                   /protein_id="ADD26866.1"
FT                   /translation="MSFSTGNAYQITFNDNNLATSGPAEPPLWKQILGGLGDVSSLLDP
FT                   YIYTDQEKARYDLLKAQAEAEKARALAEAEKARAAGIAVQPQPAVPAWVWVVGAAALVL
FT                   VLVLMLRD"
     MSFSTGNAYQ ITFNDNNLAT SGPAEPPLWK QILGGLGDVS SLLDPYIYTD QEKARYDLLK        60
     AQAEAEKARA LAEAEKARAA GIAVQPQPAV PAWVWVVGAA ALVLVLVLML RD               112
//

If you have problems or comments...

PBIL Back to PBIL home page