(data stored in ACNUC7421 zone)

EMBL: CP001743.PE86

CP001743.PE86        Location/Qualifiers
FT   CDS             complement(69974..70483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0087"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Q859S8 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26868"
FT                   /protein_id="ADD26868.1"
FT                   /translation="MQEAFNRIKTIRPSARPITLIKGGPDYRDYTGRQRVKVAEFVVPQ
FT                   GASWVIANPLPVVLKLYDTGGNQLPHDTDVFLARKTRGFDAPEFLGKIQYAGYYDLSEA
FT                   QQRDAKYYQNILATLSPAKGGVTPQGFAFREGDILEVYVESSATPALADARTRIELPVG
FT                   VDNSTI"
     MQEAFNRIKT IRPSARPITL IKGGPDYRDY TGRQRVKVAE FVVPQGASWV IANPLPVVLK        60
     LYDTGGNQLP HDTDVFLARK TRGFDAPEFL GKIQYAGYYD LSEAQQRDAK YYQNILATLS       120
     PAKGGVTPQG FAFREGDILE VYVESSATPA LADARTRIEL PVGVDNSTI                   169
//

If you have problems or comments...

PBIL Back to PBIL home page