(data stored in ACNUC7421 zone)

EMBL: CP001743.PE88

CP001743.PE88        Location/Qualifiers
FT   CDS             complement(71064..71738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0089"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Q859T0 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26870"
FT                   /protein_id="ADD26870.1"
FT                   /translation="MAGRQTFRILIVGKSGSGKSTLARQILLRMVGRFRKLVIVNRKTE
FT                   FSDLCEARFRVKEEGDPSRALRRHSRVFFHVTGYDPRAFLDALGAEIMRQRDVLLLVDE
FT                   AYHFFPRGAVPKGLFEVLTGGREAGHNAIFVTQMLQGLTGGIDPGVRKQASHLVTFRVT
FT                   EPNDVRAVSEHFPELGERVRTLARPDDGLPPEYGVKNLDREEGGLVLRNPQNPRRRMWV
FT                   RL"
     MAGRQTFRIL IVGKSGSGKS TLARQILLRM VGRFRKLVIV NRKTEFSDLC EARFRVKEEG        60
     DPSRALRRHS RVFFHVTGYD PRAFLDALGA EIMRQRDVLL LVDEAYHFFP RGAVPKGLFE       120
     VLTGGREAGH NAIFVTQMLQ GLTGGIDPGV RKQASHLVTF RVTEPNDVRA VSEHFPELGE       180
     RVRTLARPDD GLPPEYGVKN LDREEGGLVL RNPQNPRRRM WVRL                        224
//

If you have problems or comments...

PBIL Back to PBIL home page