(data stored in ACNUC7421 zone)

EMBL: CP001743.PE92

CP001743.PE92        Location/Qualifiers
FT   CDS             complement(73521..73934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0093"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bbk:BARBAKC583_0145 TolA domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26874"
FT                   /protein_id="ADD26874.1"
FT                   /translation="MTLRLPEPLLAEPVEMPALQPEAPRQVEAVPLGPDELDPVVTQAV
FT                   ESQPEVSMPKTAAVENENPSEKVSKEKAEPANPKPTPKSVQGYAVAVLGAVLVVAAAVL
FT                   GMKGGTGATTPCGNCGGNRTGGSAVSGSGPIIY"
     MTLRLPEPLL AEPVEMPALQ PEAPRQVEAV PLGPDELDPV VTQAVESQPE VSMPKTAAVE        60
     NENPSEKVSK EKAEPANPKP TPKSVQGYAV AVLGAVLVVA AAVLGMKGGT GATTPCGNCG       120
     GNRTGGSAVS GSGPIIY                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page