(data stored in ACNUC7421 zone)

EMBL: CP001743.PE95

CP001743.PE95        Location/Qualifiers
FT   CDS             complement(74854..75225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0096"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpd:BURPS668_2992 Smr domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26877"
FT                   /protein_id="ADD26877.1"
FT                   /translation="MNDKKLNPLRLVLLTVLIGYFAFLFTRPQPEEPLVTQAPAPATTP
FT                   APTATPTNCLGQITQVAQGANEIRLTITGSAERILVYTDQGNITAATPEVGSGGEYRIR
FT                   TPGPATAVQLDDCPVLNLR"
     MNDKKLNPLR LVLLTVLIGY FAFLFTRPQP EEPLVTQAPA PATTPAPTAT PTNCLGQITQ        60
     VAQGANEIRL TITGSAERIL VYTDQGNITA ATPEVGSGGE YRIRTPGPAT AVQLDDCPVL       120
     NLR                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page