(data stored in SCRATCH zone)

EMBL: CP001778.PE100

CP001778.PE100       Location/Qualifiers
FT   CDS             110775..111353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0102"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: scl:sce6308
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39823"
FT                   /db_xref="GOA:D3Q0F9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q0F9"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADD39823.1"
FT                   /translation="MEPGLRERKKQRTRDALVAAAVDLFQRQGYEHTTVAQIAEAAELS
FT                   TRTFFLHFPTKEDVLLANTDRRIAAGVQAITTHRANTPLATVLLTAMERMIDDADPSDL
FT                   TQLRAQLLVRTPALQARLFQRLFSGQTALIDALTTTFDVDRVEAAARVGAMIGAVNAAT
FT                   LASLDQGDPPSRQREAMTRAARLAVTPPA"
     MEPGLRERKK QRTRDALVAA AVDLFQRQGY EHTTVAQIAE AAELSTRTFF LHFPTKEDVL        60
     LANTDRRIAA GVQAITTHRA NTPLATVLLT AMERMIDDAD PSDLTQLRAQ LLVRTPALQA       120
     RLFQRLFSGQ TALIDALTTT FDVDRVEAAA RVGAMIGAVN AATLASLDQG DPPSRQREAM       180
     TRAARLAVTP PA                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page