(data stored in SCRATCH zone)

EMBL: CP001778.PE122

CP001778.PE122       Location/Qualifiers
FT   CDS             131708..132625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0124"
FT                   /product="pyruvate carboxyltransferase"
FT                   /note="PFAM: pyruvate carboxyltransferase; KEGG:
FT                   scl:sce4321 hydroxymethylglutaryl-CoA lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39845"
FT                   /db_xref="GOA:D3Q1J7"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1J7"
FT                   /inference="protein motif:PFAM:PF00682"
FT                   /protein_id="ADD39845.1"
FT                   /translation="MTTALPSSVSIREVGPRDGLQSENPIAVADKVRLINALSRTGLSR
FT                   VEAVAFVHPRAIPQMANADEVWEAVDRNPDVRYSALVPNLKGADRALKAGFTELEVVVS
FT                   ASDTHNRKNINRSTDESLDALGELIATVHDGGATAEVIVATSFGCPYEGDIAASRVAWV
FT                   VDRAVAAGADRVAFGDTTGMGTPRRVRELLEAVRASQPDIPILLHFHNTRGTALANVLT
FT                   ALEYGVTEFDASVGGLGGCPYAPGASGNLATEELVHMLHDMGIDTGVDLDALLEVAVMA
FT                   EGLVGRELPSGVLRAGPRTRLTPL"
     MTTALPSSVS IREVGPRDGL QSENPIAVAD KVRLINALSR TGLSRVEAVA FVHPRAIPQM        60
     ANADEVWEAV DRNPDVRYSA LVPNLKGADR ALKAGFTELE VVVSASDTHN RKNINRSTDE       120
     SLDALGELIA TVHDGGATAE VIVATSFGCP YEGDIAASRV AWVVDRAVAA GADRVAFGDT       180
     TGMGTPRRVR ELLEAVRASQ PDIPILLHFH NTRGTALANV LTALEYGVTE FDASVGGLGG       240
     CPYAPGASGN LATEELVHML HDMGIDTGVD LDALLEVAVM AEGLVGRELP SGVLRAGPRT       300
     RLTPL                                                                   305
//

If you have problems or comments...

PBIL Back to PBIL home page